Entry information : OsPrx06(LOC_Os01g18890)
Entry ID 1016
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-09 (Christophe Dunand)
Peroxidase information: OsPrx06(LOC_Os01g18890)
Name OsPrx06(LOC_Os01g18890)
Class Class III peroxidase    [Orthogroup: Prx217]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx06
start..stop
S start..stop
ZmPrx121 510 0 15..336 16..333
SbPrx56 508 0 15..336 19..334
TaPrx131-1A 478 3.44e-171 30..336 29..330
BdiPrx58 471 1.94e-168 3..336 2..335
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx06(LOC_Os01g18890)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9LGU0
DNA ref. GenBank:   NC_008394.1 (10685565..10679554)
Protein sequence: OsPrx06(LOC_Os01g18890)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (304)
PWM (Da):   %s   36246.42 (32842.7) Transmb domain:   %s   i12-29o
PI (pH):   %s   9.16 (8.95) Peptide Signal:   %s   cut: 33 range:33-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MCSAARGVRRHGSPVIIAWAIVFFSVFASSEAQLQVGYYNYTCPR
AEDLVRNVVRAAILRDPGNGPGLVRLFFHDCFVR
GCDASVLLDAVPGSNARVEKMSQANNPSLRGFAVIDRAKRVLERRCRGTVSCADIVAFAARDACGIMGGIDFAVPSGRRDGAVSAESDVLNNLPPPFFNATQLVAGFAAKNLTADDMVVL
SGAHSFGRSHCSAFSFRLYPQVAPDMDAAYAAQLRARCPPPAAPPATGRRDRVVDLDPVTKLVLDNQYYKNIQRGEVLFTSDATLVSQSDTAALVDLYARNRKLWASRFAAAMVKMGNLD
VLTGSQGEIRKFCNRVN*

Retrieve as FASTA  
Remarks chromosome 1. No ESTs. Incorrect prediction from Phytozome (Exon 1 and start of exon 2 are missing, extra intron in 3' leading to the lack of GEIR). Exon 1 detected 6000 bp upstream
DNA
Send to BLAST
CDS
Send to BLAST