1. Browse the Database
  2. View Redoxidase
Entry information : EgrKat01-1 ( Eucgr.F01775 / Egrandis_v1_0.010394m)
Entry ID 10160
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EgrKat01-1 ( Eucgr.F01775 / Egrandis_v1_0.010394m)
Name (synonym) EgrKat01-1 ( Eucgr.F01775 / Egrandis_v1_0.010394m)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrKat01-1
start..stop		 S start..stop
EglKat01-1 1017 0 5..492 1..488
EgrKat01-2 1005 0 1..492 1..492
EcamKat01 1003 0 5..492 3..504
EglKat01-2 995 0 5..492 3..490
Gene structure Fichier Exons►


exon

Literature and cross-references EgrKat01-1 ( Eucgr.F01775 / Egrandis_v1_0.010394m)
DNA ref. Phytozome 12:   scaffold_6 (23062046..23067198)
Protein sequence: EgrKat01-1 ( Eucgr.F01775 / Egrandis_v1_0.010394m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492 (307)
PWM (Da):   %s   56889.49 (33429.3) Transmb domain:   %s   i9-31o
PI (pH):   %s   7.24 (4.65) Peptide Signal:   %s   cut: 23 range:23-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTRGNFDLVGINFPVFFIRDAMKFPD
AIHAFKPNPKSNIQEMWRIIDFLSHQPESLSTFAWFFDDVGIPQDYRHMEGFGVHAFTFINKAGKTNYVKFHWKPTCGVKCLLEEEAIRIGGSNHSHATKDLYDSIAAGNYPEWKLYIQV
MDPALEDSFDFDPLDMTKIWPEDILPLQPVGRLVLNQNVDNFFAENEQLAFNPAFVVPGIYFSNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYF
PSKFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWISYWTADKSIGQKLASSLSARPSM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_6, 7 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST