Entry information : OsPrx07 (LOC_Os01g18910)
Entry ID 1017
Creation 2009-01-08 (Christophe Dunand)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: OsPrx07 (LOC_Os01g18910)
Name (synonym) OsPrx07 (LOC_Os01g18910)
Class Class III peroxidase    [Orthogroup: Prx083]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx07
start..stop
S start..stop
OsiPrx07 604 0 1..308 1..317
OsPrx101 567 0 1..308 1..316
OsPrx100 567 0 1..308 1..316
TaPrx123-1D 425 3.09e-151 4..308 9..320
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx07 (LOC_Os01g18910)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004).
Protein ref. UniProtKB:   Q5U1T6
DNA ref. GenBank:   NC_008394.1 (10690570..10689477)
Protein sequence: OsPrx07 (LOC_Os01g18910)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   308 (288)
PWM (Da):   %s   31927.85 (29778.7)  
PI (pH):   %s   5.32 (5.07) Peptide Signal:   %s   cut: 21 range:21-308
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLILMVAFQAMSLISISTASLQYNFYGSSCPNAEQTISNVVYGLIDADPSMAPALLRLHFHDCFVMGCDASILLDPTKANGSPEKTAIPLRGYDAVNKIKAAVEAVCPGKVSCADILAF
AARDSVTKSGGFVYPVPSGRRDGDVSSAFSVFSSIPSPFFDADELVQSFAAKGLTVDDLVALSGAHSIGTAHCSGFKNRLYPTVDASLDASYxGGAAADDGVVNNSPVSPATLGNQYFKN
ALAGRVLFTSDAALLAGRNDTAEKVRENAGDLTAWMARFAASMVKMGGIEVLTGARGEVRGFCNATNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). No ESTs. Based on initial annotation: frame shift and short missing sequence (AEALRAACPD) after DASLDASY. Missing sequence is detected in Indica. Missing 'c'.
DNA
Send to BLAST