1. Browse the Database
  2. View Redoxidase
Entry information : EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Entry ID 10171
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-25 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-28 (Christophe Dunand)
Peroxidase information: EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Name (synonym) EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrGPx04
start..stop		 S start..stop
EguGPx04 341 1.58e-122 1..170 1..170
EglGPx04 296 7.95e-105 17..160 1..144
VvGPx08 274 4.17e-96 1..170 1..170
LeGPx08 274 5.02e-96 1..167 1..167
Gene structure Fichier Exons►


exon

Literature and cross-references EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
DNA ref. Phytozome 12:   scaffold_4 (32590346..32587065)
Protein sequence: EgrGPx04 ( Eucgr.D01856 / Egrandis_v1_0.029050m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19371.79  
PI (pH):   %s   4.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQLMQDPQPIYELAVKDEKGNDVSLGEYRGKVLLIVNVASKCGLTNSNYTELNQLYERYKDGLEILAFPCNQFGNEEPGTNNEIKEFVCTRFKSEFPIFDIEVNGDKEAPLYKFLKSG
KWGMFKDDIQWNFAKFLVDQNGVIINRYYPTTSPLTIEGDMKKLLGIS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_4, 5 introns). Correct prediction from phytozome.
DNA ►
Send to BLAST
CDS►
Send to BLAST