Entry information : EgrKat[P]07
Entry ID 10187
Creation 2012-01-25 (Qiang Li)
Last sequence changes 2012-01-27 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Achraf Jemmat
Last annotation changes 2015-11-03 (Achraf Jemmat)
Peroxidase information: EgrKat[P]07
Name EgrKat[P]07
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrKat[P]07
start..stop
S start..stop
EglKat[P]07 369 2e-133 1..177 1..177
EguKat[P]07 359 3e-129 1..182 1..182
EgrKat[P]05 342 1e-120 6..177 150..321
EguKat[P]05 340 7e-120 6..177 150..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10280..10547 268 N° 2 10857..10972 116 N° 3 11148..11209 62 N° 4 11293..11395 103
join(10280..10547,10857..10972,11148..11209,11293..11395)


exon

Literature and cross-references EgrKat[P]07
DNA ref. Phytozome 12:   scaffold_215 (10280..11395)
Protein sequence: EgrKat[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182
PWM (Da):   %s   21194.61  
PI (pH):   %s   8.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PKTYCPLMLVGRLVLNKNIDNFFAENEQLAFCPSIVVPGVYYSDDKLLQIRIFSYSDAQRDRLAPNYLQLPSNAPKCSHHSSHHEGFMNCLISLLQINYFPSSYNPVRHAERYPIPTAMLTGKREKGIEKENNFKQPGERYRSRAPDRQERFICRWIDALSEPRMTHEIHSIWISYRSEVR

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short PS). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCTAGTTGGCCGCTTGGTCTTGAATAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTC
TACTACTCAGACGATAAGCTGCTCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCTCTCATCAC
AGCAGTCACCATGAAGGTTTCATGAATT
GCCATGCATAGGATGAAGAGGTAAGAATTTTCTTTGAATCCTTCCTCAGCAATACTCTGGGCAGCATCTCTTGTGGATTTTTTGTTGATGTA
ACCAAGTTAGACATCACGCTCTCCTATAAGTATGAAGGCCTAGTGATGCATTCTGACATGTCAATTGTGGATCCCAAAGTGGCGGTGCGAACCCTCCTTTTGTTGGAGGATTACTTTCTT
GATTTTTCTACTGCCCTTTGTGCCTGAAACATGCATGTTTACATATGTAGGAAATACCTTTCTGCTATCATGTAAAATGATTATCTGTTGAGCAAATGTTTAATTTCCCTTTTGCAGATA
AACTATTTTCCTTCAAGTTATAATCCCGTTCGTCATGCGGAGAGATATCCCATTCCAACTGCTATGCTGACTGGAAAGCGTGAAAAAGGTATG
TTTTGTAGGATCTCTTTTACTTGGATA
GAGATTGATTGTCCTGAGGTGCTTTCATGGTGATATCCGTGGGATATACTCAACTTGTCCTAGATGATCAATTGAATTGCAGTGAGTGGTATGACTGATGTATGTGTGTTTGGATCTTGT
TATCTTTTGTTTCTCCTGGCAGACCAACATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCTGACAGGTATTGTTCAGTTGTGCATCTCCTGAAAAT
GGTTTGATTGTCTCATGTTTCTCAATAATCTGTCTCTATCTTTCTTTTCTCAGGCAAGAGCGGTTCATCTGCCGATGGATCGATGCTTTGTCTGAACCACGTATGACTCATGAGATCCAC
AGCATCTGGATTTCATATAGGTCGGAGGTGAGATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGAAGACATATTGCCCCCTAATGCTAGTTGGCCGCTTGGTCTTGAATAAGAACATTGATAACTTCTTTGCTGAGAATGAACAGCTTGCATTTTGCCCTTCAATTGTGGTTCCTGGCGTC
TACTACTCAGACGATAAGCTGCTCCAAATTCGTATTTTCTCATATTCTGATGCTCAGAGGGACCGCCTTGCACCAAATTATCTTCAACTCCCTTCTAATGCTCCTAAATGCTCTCATCAC
AGCAGTCACCATGAAGGTTTCATGAATT
GTTTAATTTCCCTTTTGCAGATAAACTATTTTCCTTCAAGTTATAATCCCGTTCGTCATGCGGAGAGATATCCCATTCCAACTGCTATGCTG
ACTGGAAAGCGTGAAAAAGGTATG
ATTGAGAAAGAGAACAACTTCAAGCAGCCTGGAGAGAGATACCGATCAAGGGCGCCTGACAGGCAAGAGCGGTTCATCTGCCGATGGATCGATGCT
TTGTCTGAACCACGTATGACTCATGAGATCCACAGCATCTGGATTTCATATAGGTCGGAGGTGAGATGA

Retrieve as FASTA