Entry information : OsPrx10(LOC_Os01g18970)
Entry ID 1020
Creation 2005-06-16 (Filippo Passardi)
Last sequence changes 2005-06-16 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx10(LOC_Os01g18970)
Name OsPrx10(LOC_Os01g18970)
Class Class III peroxidase    [Orthogroup: Prx337]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx10
start..stop
S start..stop
OsPrx09 575 0 1..344 1..347
SbPrx58 353 8.76e-122 1..345 1..345
SiPrx08 350 2.6e-120 23..345 24..345
ZmPrx44 346 5.63e-119 1..345 1..345
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1020' 'complement(join(10718495..10719301,10719469..10719699))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10719469..10719699 229 N° 2 10718495..10719301 805  
complement(join(10718495..10719301,10719469..10719699))


exon

Literature and cross-references OsPrx10(LOC_Os01g18970)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1T3
DNA ref. GenBank:   NC_008394.1 (10719699..10718498)
Protein sequence: OsPrx10(LOC_Os01g18970)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (326)
PWM (Da):   %s   36199.25 (34223.2) Transmb domain:   %s   i12-34o
PI (pH):   %s   5.38 (4.97) Peptide Signal:   %s   cut: 20 range:20-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKVFMAVCMLAVAVRLAAAIVVPSAAPCALTVGFYNGKCGNVSVE
SVVYDTVKAFLDADKSKGAALVRLLFHDCFVN
GCDGSILLDNSTTNPSPEKFAGANLGIAGLDVIDAVKAKLETACPGVVSCADIVVFAGRDASRYMSNGGVNFDVPAGRLDGIVSSSVDAQNTLPDSKADIGKLIANFAAKGFTPEELVIL
SGAHSIGKAHCSNFDDRLTAPDSEINADYRDNVLSKTCKSAPNPTLANNIRDIDAATLGDLASYVVPAVGGDYLDNSYYKNNKNNLVLFNSDWALVGSNATLQHVNEYAENGTLWNIDFA
QALVKLSKLAMPAGSVRQIRKTCRAINY*

Retrieve as FASTA  
Remarks chromosome 1. No ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTTTTCATGGCAGTGTGCATGTTGGCGGTGGCCGTCCGGCTAGCCGCCGCCATCGTGGTGCCGTCGGCGGCGCCGTGCGCGTTGACGGTGGGTTTCTACAATGGCAAGTGCGGC
AACGTCAGCGTCGAGTCCGTCGTGTACGATACTGTGAAGGCCTTCCTCGATGCTGACAAATCCAAGGGCGCCGCCCTCGTGCGCCTGTTGTTCCATGACTGCTTCGTCAAT
GTAAACACG
ATATGCTCCCGGAAATTACACCATGCGTGCTCTAATCACAATTATTTTGATGGTTAATTTGCTAGTATTTATCAGTCGTCTGATTAATTTTTAGTGTGCTATGTTTATATTTATCTGTGA
CTGAATGTTAATATCTGTACTGTTGTTTTTTACATTAGGGGGGTGTGACGGATCGATCCTTCTTGATAATTCGACCACAAATCCTTCACCGGAGAAGTTCGCCGGTGCGAACCTCGGCAT
CGCCGGGCTCGACGTGATCGACGCGGTCAAGGCCAAGCTCGAGACCGCATGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTGTTCGCTGGCCGCGACGCGTCGAGGTACATGAGCAA
CGGCGGCGTCAACTTCGACGTCCCGGCCGGCCGCCTCGACGGCATCGTCTCGTCCTCCGTGGACGCCCAAAATACGCTCCCTGACTCCAAGGCCGACATTGGCAAGCTCATCGCCAACTT
CGCGGCGAAGGGGTTCACCCCGGAGGAGCTGGTCATCCTCTCCGGCGCGCACTCCATCGGCAAGGCGCACTGCTCCAACTTCGACGACCGCCTCACCGCGCCGGACTCCGAGATCAACGC
CGACTACCGCGACAACGTCCTGAGCAAGACCTGCAAATCCGCCCCGAACCCGACGCTGGCGAACAACATCCGCGACATCGACGCGGCGACGCTGGGGGACCTGGCGAGCTACGTCGTGCC
GGCCGTCGGCGGCGACTACCTGGACAACAGCTACTACAAGAACAACAAGAACAACCTGGTGCTGTTCAACTCCGACTGGGCGCTCGTCGGCAGCAACGCCACGCTCCAGCACGTCAACGA
GTACGCCGAGAACGGCACGCTCTGGAACATCGACTTCGCGCAGGCGCTCGTCAAGCTCAGCAAGCTGGCCATGCCGGCGGGCAGCGTCCGCCAGATCAGGAAGACGTGCCGCGCCATCAA
CTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGTTTTCATGGCAGTGTGCATGTTGGCGGTGGCCGTCCGGCTAGCCGCCGCCATCGTGGTGCCGTCGGCGGCGCCGTGCGCGTTGACGGTGGGTTTCTACAATGGCAAGTGCGGC
AACGTCAGCGTCGAGTCCGTCGTGTACGATACTGTGAAGGCCTTCCTCGATGCTGACAAATCCAAGGGCGCCGCCCTCGTGCGCCTGTTGTTCCATGACTGCTTCGTCAAT
GGGTGTGAC
GGATCGATCCTTCTTGATAATTCGACCACAAATCCTTCACCGGAGAAGTTCGCCGGTGCGAACCTCGGCATCGCCGGGCTCGACGTGATCGACGCGGTCAAGGCCAAGCTCGAGACCGCA
TGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGTGTTCGCTGGCCGCGACGCGTCGAGGTACATGAGCAACGGCGGCGTCAACTTCGACGTCCCGGCCGGCCGCCTCGACGGCATCGTC
TCGTCCTCCGTGGACGCCCAAAATACGCTCCCTGACTCCAAGGCCGACATTGGCAAGCTCATCGCCAACTTCGCGGCGAAGGGGTTCACCCCGGAGGAGCTGGTCATCCTCTCCGGCGCG
CACTCCATCGGCAAGGCGCACTGCTCCAACTTCGACGACCGCCTCACCGCGCCGGACTCCGAGATCAACGCCGACTACCGCGACAACGTCCTGAGCAAGACCTGCAAATCCGCCCCGAAC
CCGACGCTGGCGAACAACATCCGCGACATCGACGCGGCGACGCTGGGGGACCTGGCGAGCTACGTCGTGCCGGCCGTCGGCGGCGACTACCTGGACAACAGCTACTACAAGAACAACAAG
AACAACCTGGTGCTGTTCAACTCCGACTGGGCGCTCGTCGGCAGCAACGCCACGCTCCAGCACGTCAACGAGTACGCCGAGAACGGCACGCTCTGGAACATCGACTTCGCGCAGGCGCTC
GTCAAGCTCAGCAAGCTGGCCATGCCGGCGGGCAGCGTCCGCCAGATCAGGAAGACGTGCCGCGCCATCAACTATTAA

Retrieve as FASTA