Entry information : GluxDyPrx07
Entry ID 10205
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-04-03 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-23 (Christophe Dunand)
Peroxidase information: GluxDyPrx07
Name GluxDyPrx07
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Gymnopus
Organism Gymnopus luxurians    [TaxId: 206324 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GluxDyPrx07
start..stop
S start..stop
GluxDyPrx08 845 0 1..500 1..509
GluxDyPrx03 838 0 1..500 1..516
GluxDyPrx06 754 0 1..499 1..515
GluxDyPrx04 725 0 1..499 1..531
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 767282..767396 115 N° 2 767449..767545 97 N° 3 767604..768049 446 N° 4 768109..768398 290
N° 5 768464..768686 223 N° 6 768740..768808 69 N° 7 768860..768926 67 N° 8 768988..769002 15
N° 9 769153..769156 4 N° 10 769213..769312 100 N° 11 769367..769443 77  
join(767282..767396,767449..767545,767604..768049,768109..768398,768464..768686, 768740..768808,768860..768926,768988..769002,769153..769156,769213..769312,76936 7..769443)


exon

Literature and cross-references GluxDyPrx07
DNA ref. JGI genome:   scaffold_16 (767282..769443)
Cluster/Prediction ref. JGI gene:   41170
Protein sequence: GluxDyPrx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   500 (481)
PWM (Da):   %s   53285.75 (51167.6)  
PI (pH):   %s   4.33 (4.25) Peptide Signal:   %s   cut: 20 range:20-500
Sequence 541
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLTHFSLLVAFVLQGVYAVPNLPSNDLKPRRTSSILINPAAQPALPSAQQAASSSASVGLNLTNIQGDILIGMKKNKELFFFFSIVDPTSFKSQLGADILPLITSTTELLAVSTQPNTLVNIAFSQRGLTALGITDNLGDSLFTAGQLNDASSLGDTTSNWVSEFAGTSIDGVLLLASDTVDNINNTLSQLQSTLNGSISEVYSIQGQARPGNEQGHEHFGFMDGISNPAIDGFSTPLPGQAVVAPGIILVGEQGDGTTRPSWAIDGSFLAFRQLEQRVPEFNKFLIDNALSEPNLTVDQNTELLGARMMGRWKSGAPVDLTPLVDDPVLAADPQRNNNFNYTHPDFNLATDQSHCPFSAHIRKTNPRADIGGSFSEHIIRAGIPYGPEVTDAEAASNVSSTDPTLERGLAFVAYQANIGNGFAFLQQFWANNINFHTCDVGQDPIIGVATPDGPRSVGGLDPLDSTRDITLNQDFVISRGGEYFFSPSLSAIQNTFSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTCACCCACTTTTCTTTATTGGTGGCCTTTGTGCTACAGGGCGTGTATGCTGTCCCAAATCTTCCATCCAATGACCTGAAACCTAGACGAACGAGCTCGATTCTCATCAGTAAGT
ATTCAAAGGGAAAATCGCGAAAACTCAAAAGCTTAGGAATCTGCAGATCCTGCTGCTCAGCCTGCCTTGCCGTCCGCCCAGCAGGCAGCGAGCTCTTCCGCTTCAGTGGGCCTGAACCTC
ACCAACATCCAGGGAGATATTCT
GTAAGTGTTCTCTTTAATCCCATTTGGTGTTTATTTTATGTCTGATTCGATACCAAAGTATCGGGATGAAGAAAAACAAAGAGTTGTTCTTCTTTTT
TAGCATCGTAGACCCGACATCCTTCAAGTCCCAACTTGGAGCGGATATTCTCCCCTTGATTACATCAACTACTGAACTGCTCGCGGTTAGCACGCAACCTAATACCCTTGTCAACATTGC
CTTCTCTCAGAGGGGCCTTACGGCATTGGGAATAACAGACAACTTGGGCGACTCCCTTTTTACGGCCGGACAATTAAATGACGCCTCAAGCTTGGGTGATACTACTAGCAACTGGGTATC
GGAGTTTGCTGGTACCAGTATCGACGGTGTCCTCCTCCTCGCTTCGGACACAGTAGATAATATCAACAACACGCTATCCCAACTCCAAAGTACTTTGAACGGTTCGATTTCTGAAGTTTA
CAGTATCCAGGGTCAAGCGAGACCAGGAAATGAGCAGGGCCACGAAC
GTAAGATTTATTTCGTTTGTCTCAGTATGAGCAACAGTAATTAAAGCACCGTTATGCAGATTTTGGATTCATG
GATGGAATTAGCAACCCAGCAATTGATGGTTTCTCTACGCCTCTTCCAGGTCAAGCAGTCGTTGCACCGGGCATTATTCTGGTTGGAGAACAGGGCGACGGAACGACACGTCCTTCTTGG
GCTATAGACGGCTCGTTCCTTGCCTTCCGTCAACTTGAACAGCGTGTCCCCGAGTTCAACAAATTTTTGATTGACAATGCTCTATCTGAACCCAATCTCACTGTCGATCAAAATACAGAA
CTTCTTGGAGCTCGGATGATGGGACGATGGAAGAGT
GTAAGTGGACCAATCGGTTGTCTCTACCTTCACCAAGTCTGTATTGACTCGTAATTCCTCGATAGGGAGCTCCGGTTGATCTCA
CTCCTTTGGTGGACGATCCTGTTCTTGCGGCGGATCCTCAACGGAACAACAACTTCAACTATACTCATCCTGATTTTAACCTAGCCACCGACCAATCTCACTGTCCTTTCTCGGCACATA
TCCGAAAGACCAACCCTCGTGCAGACATAGGAGGAAGCTTCAGTGAGCATATCATTCGTGCTGGAATTCCGTATGGACCGGAAG
GTACGTTCTGCAAACCTTATCGGGTCCTCGCTGTTC
ATGCTGATCATGCTTAGTTACTGACGCCGAGGCTGCTTCCAACGTCTCGAGCACAGATCCTACTCTCGAGCGAGGCTTAGCTTTTGGTATGAAAGTCTATATATGTACCAAGTACGAAAC
TAAAACCTGTCGTTCAGTCGCATATCAAGCAAACATCGGCAACGGATTTGCATTCCTCCAGCAATTTTGGGCCAATAATATCAAGTGAGTTGTGGATTTTTTCTTTGGTTTGACTTCGTA
GCAGAGGCTGAATCGCGTATCACAGTTTCCACACATGTGAGTTATTTCATCGGTCTGTATGGATTTTTTCTTGACCTGTATTTCTCCTTTCTTTCGCAATTGCAGCGGGGTAAGTGCTCA
ATCCTTTCTCAAGCTCTTCAATGCTTCTGACAACCACTTTCGTATCTCTTTTTCTTTCTCTTATAAATAGCGTTGTAAGTGCCAGATTTATCGAGTAAAAGATTCTTTGTTCTCTAAGTT
CCTTCCGTAGGGCCAAGATCCCATTATCGGCGTCGCAACGCCAGACGGACCTAGAAGTGTTGGTGGCCTTGACCCTTTGGACTCGACGAGGGATATAACCCTGAACCAAGGTACATTTCC
AAGCTTTTGTTGGTTATCGTCATAATGGACTTATTCTCCTTCAGATTTCGTCATTTCCCGAGGAGGAGAATACTTTTTCTCGCCCTCTCTTTCGGCTATTCAAAACACGTTCTCTGCTTA
G

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTCACCCACTTTTCTTTATTGGTGGCCTTTGTGCTACAGGGCGTGTATGCTGTCCCAAATCTTCCATCCAATGACCTGAAACCTAGACGAACGAGCTCGATTCTCATCAATCCTG
CTGCTCAGCCTGCCTTGCCGTCCGCCCAGCAGGCAGCGAGCTCTTCCGCTTCAGTGGGCCTGAACCTCACCAACATCCAGGGAGATATTCT
TATCGGGATGAAGAAAAACAAAGAGTTGT
TCTTCTTTTTTAGCATCGTAGACCCGACATCCTTCAAGTCCCAACTTGGAGCGGATATTCTCCCCTTGATTACATCAACTACTGAACTGCTCGCGGTTAGCACGCAACCTAATACCCTTG
TCAACATTGCCTTCTCTCAGAGGGGCCTTACGGCATTGGGAATAACAGACAACTTGGGCGACTCCCTTTTTACGGCCGGACAATTAAATGACGCCTCAAGCTTGGGTGATACTACTAGCA
ACTGGGTATCGGAGTTTGCTGGTACCAGTATCGACGGTGTCCTCCTCCTCGCTTCGGACACAGTAGATAATATCAACAACACGCTATCCCAACTCCAAAGTACTTTGAACGGTTCGATTT
CTGAAGTTTACAGTATCCAGGGTCAAGCGAGACCAGGAAATGAGCAGGGCCACGAAC
ATTTTGGATTCATGGATGGAATTAGCAACCCAGCAATTGATGGTTTCTCTACGCCTCTTCCAG
GTCAAGCAGTCGTTGCACCGGGCATTATTCTGGTTGGAGAACAGGGCGACGGAACGACACGTCCTTCTTGGGCTATAGACGGCTCGTTCCTTGCCTTCCGTCAACTTGAACAGCGTGTCC
CCGAGTTCAACAAATTTTTGATTGACAATGCTCTATCTGAACCCAATCTCACTGTCGATCAAAATACAGAACTTCTTGGAGCTCGGATGATGGGACGATGGAAGAGT
GGAGCTCCGGTTG
ATCTCACTCCTTTGGTGGACGATCCTGTTCTTGCGGCGGATCCTCAACGGAACAACAACTTCAACTATACTCATCCTGATTTTAACCTAGCCACCGACCAATCTCACTGTCCTTTCTCGG
CACATATCCGAAAGACCAACCCTCGTGCAGACATAGGAGGAAGCTTCAGTGAGCATATCATTCGTGCTGGAATTCCGTATGGACCGGAAG
TTACTGACGCCGAGGCTGCTTCCAACGTCT
CGAGCACAGATCCTACTCTCGAGCGAGGCTTAGCTTTTG
TCGCATATCAAGCAAACATCGGCAACGGATTTGCATTCCTCCAGCAATTTTGGGCCAATAATATCAATTTCCACACATGTG
A
CGTTGGCCAAGATCCCATTATCGGCGTCGCAACGCCAGACGGACCTAGAAGTGTTGGTGGCCTTGACCCTTTGGACTCGACGAGGGATATAACCCTGAACCAAGATTTCGTCATTTCCC
GAGGAGGAGAATACTTTTTCTCGCCCTCTCTTTCGGCTATTCAAAACACGTTCTCTGCTTAG

Retrieve as FASTA