Entry information : BbotDyPrx02
Entry ID 10216
Creation 2012-01-27 (Christophe Dunand)
Last sequence changes 2012-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: BbotDyPrx02
Name BbotDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Botryobasidiaceae Botryobasidium
Organism Botryobasidium botryosum    [TaxId: 264124 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BbotDyPrx02
start..stop
S start..stop
PplDyPrx01 452 2.68e-152 4..531 12..544
SbreDyPrx01 438 1.15e-144 4..532 12..582
GluxDyPrx12 417 5.48e-141 1..532 7..563
SlutDyPrx01 427 2.28e-140 4..527 12..577
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10216' 'complement(join(91277..91536,91598..91787,91848..92075,92135..92441,92498..92634,92714..93079,93134..93253))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 93134..93253 118 N° 2 92714..93079 364 N° 3 92498..92634 135 N° 4 92135..92441 305
N° 5 91848..92075 226 N° 6 91598..91787 188 N° 7 91277..91536 258  
complement(join(91277..91536,91598..91787,91848..92075,92135..92441,92498..92634 ,92714..93079,93134..93253))


exon

Literature and cross-references BbotDyPrx02
DNA ref. JGI genome:   scaffold_83 (93253..91277)
Cluster/Prediction ref. JGI gene:   180290
Protein sequence: BbotDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   535
PWM (Da):   %s   59318.4  
PI (pH):   %s   8.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPDRHIGNCALVPLPVEEVQVSDLSNLDDIQGDPVSMCPKSVENFVFFRIDKVDIFKGHLKSFKPTTYVDVLQILYGEIAKAKEEALATGTEVKRVKIKQVQIAFSRAGLNILGETEETK
DSRFNERTMLDAKLLSMTGAHGTPSSIIRRACFTVSSPSPLV
GTAEVKKEFEGSITVVDIIRGTTRRGKYKGREHFGYQDGISQPALRGLIEPQKGQVEVNPGVILMGHRGDSVFDNAEV
TGIRRPKWTKNGTIMVFRKLEQDVVGFEDYLAENGSKWRSFIPPGYKGPDLTDKDGAELFGARLVGRWK
GTPLANAPYRDDEKLDKENWNNFNHKVKGYATPTNVHCPFTAHTRKTAPRN
LDLYIAREFTESSMIVRAGIPYGRD
VKDAERKRYREEKAAGIEFPHQEPRGLCFVCYQSCLDNGFVRQSIVFGGNNYFPVTSLVPVKHGQDPIIGAPPLKDTVHATAKGSDLAEGQVTMR
VADDGKEFDVTGFAKVRDVSAQDVKEPFFVTSRGGECFFVPSVSTLRRLATKEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGACCGTCATATCGGAAACTGTGCTCTCGTTCCACTTCCCGTGGAAGAAGTCCAGGTATCCGATCTCAGCAATCTTGATGACATCCAAGGTGATCCCGTTTCAATGTGCCCCAAG
GTAAGAGGCCAGTTTTACTTCCCTGAGATGAGGATTCATATTGGAACTTTCTAGTCTCCGTCGAAAACTTTGTTTTCTTCAGGATCGACAAAGTCGACATATTCAAAGGCCATCTCAAAT
CCTTCAAACCCACCACCTACGTCGATGTACTGCAAATCCTCTACGGGGAAATCGCCAAAGCTAAAGAAGAAGCGTTAGCCACCGGGACCGAGGTCAAGCGAGTCAAGATCAAGCAGGTTC
AGATTGCCTTCTCCCGAGCCGGATTAAACATTCTCGGCGAAACAGAGGAAACCAAAGACAGTCGTTTCAACGAGCGGACTATGCTCGATGCAAAGCTGCTCTCGATGACCGGGGCACATG
GGACCCCGTCTTCGATCATTCGCAGGGCCTGCTTCACGGTGTCTTCACCGTCGCCGCTAGTA
GTGAGTCCTTGCATTTCTCCAATGAGTTCTTCATACTTATCCAACATCACTTCGATCA
GCTGGTCCTTTGTGTGAGCAGGGGGGACTGCAGAGGTAAAGAAGGAGTTCGAGGGATCGATCACAGTTGTTGATATCATACGTGGCACGACCCGACGCGGCAAGTACAAAGGAAGGGAGC
ATTTTGGATATCAGGACGGCATTTCCCAACCTGCTCTTCG
GTACGATTACTTAGCTAACCCATTAACGCGCGGTTCTGATACACGATTATGCCCAGCGCGGGCTCATCGAGCCGCAAAAG
GGACAGGTCGAGGTTAACCCAGGTGTTATTCTCATGGGGCATCGCGGCGATTCCGTCTTCGATAACGCTGAGGTCACCGGTATTCGCCGCCCCAAATGGACGAAAAACGGCACTATAATG
GTCTTTAGGAAGCTCGAGCAGGACGTCGTCGGGTTTGAAGACTACCTTGCCGAAAACGGTTCCAAGTGGCGTAGTTTCATTCCGCCTGGTTATAAGGGCCCCGATCTGACAGATAAGGAT
GGTGCCGAGTTGTTCGGAGCGCGATTGGTAGGGAGGTGGAAATCC
GTAAGCCTTTGAAGTTCGTACGCATCGAGGCTCGCGCTTACCTTCATATTCGGTCACAGGGGGCACACCGCTTGC
CAACGCTCCGTATCGTGACGATGAGAAGCTCGACAAAGAAAACTGGAATAATTTCAACCACAAGGTCAAGGGATATGCTACTCCCACCAACGTTCATTGCCCTTTCACTGCTCATACTCG
CAAGACTGCCCCTCGCAACTTGGACCTCTATATCGCACGCGAATTCACTGAGTCATCAATGATTGTTCGCGCTGGTATCCCGTACGGCCGCGAC
GTGAGGGGTTAACGTATACTTAATTT
GACAAGGCTGTCTTACTAAATCTGATTTTGAAAGGTGTCAAGGACGCTGAGCGCAAGAGGTACCGCGAGGAAAAGGCAGCTGGCATAGAATTCCCACACCAAGAGCCCCGCGGGCTCTGT
TTCGTCTGCTATCAATCTTGCTTGGACAACGGCTTCGTCCGCCAAAGCATCGTGTTCGGGGGTAACAACTACTTCCCGGTCACAAGCCTCGTACCCGTCAAACACG
GTGATCCATTTCGT
GACCAAGCTTAGTGGCCTTTTTCTAATGCCAGTCCTCTTCCTCTTAGGCGCCAAGATCCTATTATCGGTGCGCCCCCTCTGAAAGACACCGTCCACGCCACGGCAAAGGGGTCAGATTTG
GCCGAAGGGCAGGTCACCATGCGTGTCGCAGATGATGGGAAAGAATTTGATGTTACGGGCTTTGCCAAGGTTCGCGATGTGTCGGCTCAAGACGTCAAGGAGCCCTTCTTCGTGACCTCG
CGTGGCGGAGAGTGTTTCTTCGTTCCTTCCGTGTCAACCCTGCGACGGTTGGCGACCAAGGAGCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGACCGTCATATCGGAAACTGTGCTCTCGTTCCACTTCCCGTGGAAGAAGTCCAGGTATCCGATCTCAGCAATCTTGATGACATCCAAGGTGATCCCGTTTCAATGTGCCCCAAG
TCCGTCGAAAACTTTGTTTTCTTCAGGATCGACAAAGTCGACATATTCAAAGGCCATCTCAAATCCTTCAAACCCACCACCTACGTCGATGTACTGCAAATCCTCTACGGGGAAATCGCC
AAAGCTAAAGAAGAAGCGTTAGCCACCGGGACCGAGGTCAAGCGAGTCAAGATCAAGCAGGTTCAGATTGCCTTCTCCCGAGCCGGATTAAACATTCTCGGCGAAACAGAGGAAACCAAA
GACAGTCGTTTCAACGAGCGGACTATGCTCGATGCAAAGCTGCTCTCGATGACCGGGGCACATGGGACCCCGTCTTCGATCATTCGCAGGGCCTGCTTCACGGTGTCTTCACCGTCGCCG
CTAGTA
GGGACTGCAGAGGTAAAGAAGGAGTTCGAGGGATCGATCACAGTTGTTGATATCATACGTGGCACGACCCGACGCGGCAAGTACAAAGGAAGGGAGCATTTTGGATATCAGGAC
GGCATTTCCCAACCTGCTCTTCG
CGGGCTCATCGAGCCGCAAAAGGGACAGGTCGAGGTTAACCCAGGTGTTATTCTCATGGGGCATCGCGGCGATTCCGTCTTCGATAACGCTGAGGTC
ACCGGTATTCGCCGCCCCAAATGGACGAAAAACGGCACTATAATGGTCTTTAGGAAGCTCGAGCAGGACGTCGTCGGGTTTGAAGACTACCTTGCCGAAAACGGTTCCAAGTGGCGTAGT
TTCATTCCGCCTGGTTATAAGGGCCCCGATCTGACAGATAAGGATGGTGCCGAGTTGTTCGGAGCGCGATTGGTAGGGAGGTGGAAATCC
GGCACACCGCTTGCCAACGCTCCGTATCGT
GACGATGAGAAGCTCGACAAAGAAAACTGGAATAATTTCAACCACAAGGTCAAGGGATATGCTACTCCCACCAACGTTCATTGCCCTTTCACTGCTCATACTCGCAAGACTGCCCCTCGC
AACTTGGACCTCTATATCGCACGCGAATTCACTGAGTCATCAATGATTGTTCGCGCTGGTATCCCGTACGGCCGCGAC
GTCAAGGACGCTGAGCGCAAGAGGTACCGCGAGGAAAAGGCA
GCTGGCATAGAATTCCCACACCAAGAGCCCCGCGGGCTCTGTTTCGTCTGCTATCAATCTTGCTTGGACAACGGCTTCGTCCGCCAAAGCATCGTGTTCGGGGGTAACAACTACTTCCCG
GTCACAAGCCTCGTACCCGTCAAACACG
GCCAAGATCCTATTATCGGTGCGCCCCCTCTGAAAGACACCGTCCACGCCACGGCAAAGGGGTCAGATTTGGCCGAAGGGCAGGTCACCATG
CGTGTCGCAGATGATGGGAAAGAATTTGATGTTACGGGCTTTGCCAAGGTTCGCGATGTGTCGGCTCAAGACGTCAAGGAGCCCTTCTTCGTGACCTCGCGTGGCGGAGAGTGTTTCTTC
GTTCCTTCCGTGTCAACCCTGCGACGGTTGGCGACCAAGGAGCAATGA

Retrieve as FASTA