Entry information : BaDyPrx07
Entry ID 10228
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaDyPrx07
Name BaDyPrx07
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaDyPrx07
start..stop
S start..stop
PplDyPrx01 677 0 1..643 1..685
PplDyPrx02 597 0 1..651 1..639
PgigDyPrx04 498 3e-171 13..498 9..525
GluxDyPrx02 447 5e-151 17..496 19..568
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 736980..737141 162 N° 2 737193..737538 346 N° 3 737597..737750 154 N° 4 737808..738102 295
N° 5 738158..738391 234 N° 6 738446..738611 166 N° 7 738665..738960 296 N° 8 739016..739191 176
N° 9 739252..739339 88 N° 10 739395..739436 42  
join(736980..737141,737193..737538,737597..737750,737808..738102,738158..738391, 738446..738611,738665..738960,739016..739191,739252..739339,739395..739436)


exon

Literature and cross-references BaDyPrx07
DNA ref. JGI genome:   scaffold_10 (736980..739436)
Cluster/Prediction ref. JGI gene:   169535
Protein sequence: BaDyPrx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   652
PWM (Da):   %s   72109.46  
PI (pH):   %s   7.47
Sequence 694
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEHPELDHTHLKHFSNRSILPLLKSDPQYKQLKVDGPLPDTNNVQGDIYVLFPKDFENFLFFSISNVAQFKKDLAAYNPTTTHDVLGKLHKISGAKASRGDRVEMYNSQIAFSRIGLDLLGHTEKVRDDHFDQGSMKNEFASKVLGDSGPWYEPFASQTIHGVFTIAVSHDSTCKQGTAEITAKFSDSVIITKVEGKARPGAERGHEHFGYMDGVSQPALRGLIKPRKGQLQADAGVVIMGYKGDPYLNQRPAWTKDGTLMVFRKLEQDVVGFDEYLAKAGPLWRKFLPPSQVPKVNPPLSDKEGAELFGARMVGRWKSGAPLANAPFRENPSLATDADKANDFDYSIPGVYGPTDLVCPFSCHTRKTAPRNLDPYLQQQLIETALVVRAGLPYGNEVTPAERDPNGRNLTPDRGLLFVCYQSSIEKGFWQQTKAFAGNDFFPPTGLVPQRSGQDPIIGSPEDVPSTQVVKPEFFVTSRGGEYFFVPSVATLRDWAGGLPPLITGPPTVSGKYRIKTIGQSPNSYWKLTFRTPEDPWISLAPLSAHDRAQEWNITVLSPGRYNITSVLDGSGLVKSTYGYWGYGFPVRSEGTGTVWAMQAQTIGGDTFTKISLGSGGSSYVLDSENEDRTVVHFYSKKNDALNQRWVFETVQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). Missing seq and extra seq => prob of prediction?
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGCACCCAGAGCTCGATCACACTCACCTCAAGCACTTCAGCAATCGGTCCATCCTCCCGCTCCTCAAGTCCGACCCGCAGTATAAGCAACTCAAAGTCGACGGCCCACTCCCTGACA
CCAACAACGTCCAGGGCGACATCTACGTGCTATTCCCGAAG
GTCTGTGCGCGTCACTGCACGCCTTCATTCACGCATTGACGCCACACACAGGACTTCGAGAATTTCCTGTTCTTCAGCA
TCAGCAATGTCGCACAGTTCAAGAAGGACCTAGCAGCGTACAATCCAACTACGACGCACGACGTGCTCGGCAAACTGCACAAGATATCCGGGGCCAAGGCATCGAGAGGGGATCGCGTCG
AGATGTACAACTCCCAGATCGCCTTCTCCCGCATTGGGCTGGACCTCCTTGGACACACCGAGAAGGTCCGCGACGACCACTTTGACCAAGGATCCATGAAGAACGAGTTCGCGTCGAAGG
TTCTCGGCGATAGCGGCCCGTGGTACGAGCCGTTTGCGTCGCAGACCATACACGGTGTCTTCACCATCGCTGTGAGTC
GTGAGTATCGGGCCTTTCGTCCGTACTCATGATGCAAGGGGT
CTGACATCTATTGTAGACGACTCGACGTGTAAGCAGGGCACTGCCGAGATCACAGCGAAGTTCAGTGACTCTGTTATCATTACAAAGGTAGAAGGCAAAGCGCGTCCTGGGGCAGAGCGA
GGGCACGAGCACTTCGGCTACATGGATGGAGTTTCTCAACCTGCATTACG
GTGAACAAACAAACAATTCACCCACCAGAATACGAGACTGATACCAGGGCATTCTAGGGGCCTGATCAAG
CCGCGCAAAGGGCAACTCCAGGCAGATGCAGGCGTCGTCATTATGGGCTACAAAGGCGACCCGTACTTAAACCAGCGCCCTGCTTGGACCAAGGACGGAACACTAATGGTATTCCGTAAG
CTCGAGCAAGACGTCGTTGGGTTCGACGAGTACCTCGCGAAAGCAGGTCCTCTGTGGCGCAAGTTCCTGCCTCCATCGCAGGTGCCCAAGGTAAATCCACCTCTATCGGATAAGGAAGGC
GCAGAGCTTTTCGGCGCAAGGATGGTGGGAAGGTGGAAATCG
GTACGGGAATTCTTTCGACTCGGCGTCGCTCTGGGTTGACCTGGCCGTGGCGTAGGGCGCCCCTCTTGCGAATGCTCC
GTTCCGCGAGAACCCTTCGCTCGCGACGGACGCAGACAAGGCAAATGACTTCGACTATAGCATCCCCGGCGTATACGGCCCCACCGATTTGGTCTGCCCCTTCAGTTGCCACACGCGCAA
AACCGCGCCTAGGAACTTAGATCCGTATCTCCAACAGCAGTTGATTGAGACGGCGTTAGTCGTCCGCGCTGGTCTGCCGTACGGTAACGAG
GTGGGTGATATGTTTCAGCAATTCTTGAG
GTTGGTCTGAAGGCTGTACTTGCAGGTGACTCCAGCCGAGCGGGACCCCAATGGCAGGAACCTCACACCCGATCGCGGCTTGCTCTTTGTGTGCTACCAATCATCTATCGAGAAAGGGTT
CTGGCAGCAAACGAAGGCTTTCGCGGGGAACGACTTCTTTCCTCCGACAGGTCTCGTACCTCAACGATCAG
GTAAGCCTATCATCTTCTAATGTGCCAGGTACCAGAGACTCACCCGTGT
CAAGGTCAAGACCCCATCATCGGAAGCCCGGAAGACGTCCCTTCTACACAAGTTGTAAAACCCGAGTTCTTCGTCACGTCTCGCGGTGGCGAGTATTTCTTCGTTCCGTCAGTGGCTACG
TTGCGCGACTGGGCCGGCGGCTTGCCGCCTCTCATCACTGGCCCGCCGACGGTGTCGGGGAAGTACAGGATCAAGACCATCGGACAGTCCCCAAACTCGTACTGGAAGTTGACATTCCGG
ACACCTGAGGATCCGTGGATCAGCCTTGCGCCCTTGAGTGCCCACGATAGAGCACAGGAG
GTACGTTTGTCGTTGCTCTCTTGTGGATAACGCGTCGTGACGGATCTTCTGCTAGTGGAA
TATCACTGTCCTGTCTCCTGGGCGGTACAATATCACTAGCGTGCTCGATGGGTCCGGGCTCGTGAAGTCGACGTATGGCTACTGGGGCTACGGCTTCCCCGTCCGCTCCGAGGGGACCGG
AACAGTTTGGGCCATGCAGGCCCAGACGATCGGCGGGGACACGTTCACGAA
GTACGTCTTCATGCTTTTCTACAGGCGTACACCGTGCTGAGGTTCGGCTTTTGTCCAAAGGATCAGCCT
GGGTAGCGGAGGATCGAGTTACGTACTCGACAGCGAGAACGAGGACAGAACGGTTGTTCACTTCTACTCGAAGAAAAAT
GTGAGTAATCTCGGAAAGACAAGTAGAGACATTTTTATTCA
CATCGGTACCGTAGGATGCTCTCAATCAACGCTGGGTCTTCGAGACAGTCCAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGCACCCAGAGCTCGATCACACTCACCTCAAGCACTTCAGCAATCGGTCCATCCTCCCGCTCCTCAAGTCCGACCCGCAGTATAAGCAACTCAAAGTCGACGGCCCACTCCCTGACA
CCAACAACGTCCAGGGCGACATCTACGTGCTATTCCCGAAG
GACTTCGAGAATTTCCTGTTCTTCAGCATCAGCAATGTCGCACAGTTCAAGAAGGACCTAGCAGCGTACAATCCAACTA
CGACGCACGACGTGCTCGGCAAACTGCACAAGATATCCGGGGCCAAGGCATCGAGAGGGGATCGCGTCGAGATGTACAACTCCCAGATCGCCTTCTCCCGCATTGGGCTGGACCTCCTTG
GACACACCGAGAAGGTCCGCGACGACCACTTTGACCAAGGATCCATGAAGAACGAGTTCGCGTCGAAGGTTCTCGGCGATAGCGGCCCGTGGTACGAGCCGTTTGCGTCGCAGACCATAC
ACGGTGTCTTCACCATCGCTGTGAGTC
ACGACTCGACGTGTAAGCAGGGCACTGCCGAGATCACAGCGAAGTTCAGTGACTCTGTTATCATTACAAAGGTAGAAGGCAAAGCGCGTCCTG
GGGCAGAGCGAGGGCACGAGCACTTCGGCTACATGGATGGAGTTTCTCAACCTGCATTACG
GGGCCTGATCAAGCCGCGCAAAGGGCAACTCCAGGCAGATGCAGGCGTCGTCATTATGG
GCTACAAAGGCGACCCGTACTTAAACCAGCGCCCTGCTTGGACCAAGGACGGAACACTAATGGTATTCCGTAAGCTCGAGCAAGACGTCGTTGGGTTCGACGAGTACCTCGCGAAAGCAG
GTCCTCTGTGGCGCAAGTTCCTGCCTCCATCGCAGGTGCCCAAGGTAAATCCACCTCTATCGGATAAGGAAGGCGCAGAGCTTTTCGGCGCAAGGATGGTGGGAAGGTGGAAATCG
GGCG
CCCCTCTTGCGAATGCTCCGTTCCGCGAGAACCCTTCGCTCGCGACGGACGCAGACAAGGCAAATGACTTCGACTATAGCATCCCCGGCGTATACGGCCCCACCGATTTGGTCTGCCCCT
TCAGTTGCCACACGCGCAAAACCGCGCCTAGGAACTTAGATCCGTATCTCCAACAGCAGTTGATTGAGACGGCGTTAGTCGTCCGCGCTGGTCTGCCGTACGGTAACGAG
GTGACTCCAG
CCGAGCGGGACCCCAATGGCAGGAACCTCACACCCGATCGCGGCTTGCTCTTTGTGTGCTACCAATCATCTATCGAGAAAGGGTTCTGGCAGCAAACGAAGGCTTTCGCGGGGAACGACT
TCTTTCCTCCGACAGGTCTCGTACCTCAACGATCAG
GTCAAGACCCCATCATCGGAAGCCCGGAAGACGTCCCTTCTACACAAGTTGTAAAACCCGAGTTCTTCGTCACGTCTCGCGGTG
GCGAGTATTTCTTCGTTCCGTCAGTGGCTACGTTGCGCGACTGGGCCGGCGGCTTGCCGCCTCTCATCACTGGCCCGCCGACGGTGTCGGGGAAGTACAGGATCAAGACCATCGGACAGT
CCCCAAACTCGTACTGGAAGTTGACATTCCGGACACCTGAGGATCCGTGGATCAGCCTTGCGCCCTTGAGTGCCCACGATAGAGCACAGGAG
TGGAATATCACTGTCCTGTCTCCTGGGC
GGTACAATATCACTAGCGTGCTCGATGGGTCCGGGCTCGTGAAGTCGACGTATGGCTACTGGGGCTACGGCTTCCCCGTCCGCTCCGAGGGGACCGGAACAGTTTGGGCCATGCAGGCCC
AGACGATCGGCGGGGACACGTTCACGAA
GATCAGCCTGGGTAGCGGAGGATCGAGTTACGTACTCGACAGCGAGAACGAGGACAGAACGGTTGTTCACTTCTACTCGAAGAAAAATGATG
CTCTCAATCAACGCTGGGTCTTCGAGACAGTCCAGTAA

Retrieve as FASTA