Entry information : BaDyPrx08
Entry ID 10229
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaDyPrx08
Name BaDyPrx08
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaDyPrx08
start..stop
S start..stop
BaDyPrx10 892 0 12..570 1..560
PcarDyPrx 733 0 12..570 1..561
CcinDyPrx02 588 0 2..570 53..648
GluxDyPrx10 358 8.27e-118 105..564 69..518
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10229' 'join(1435529..1435720,1435775..1435804,1435854..1435894,1435950..1436024,1436075..1436904,1436957..1437137,1437199..1437335,1437394..1437620)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1435529..1435720 190 N° 2 1435775..1435804 28 N° 3 1435854..1435894 39 N° 4 1435950..1436024 73
N° 5 1436075..1436904 828 N° 6 1436957..1437137 179 N° 7 1437199..1437335 135 N° 8 1437394..1437620 225
join(1435529..1435720,1435775..1435804,1435854..1435894,1435950..1436024,1436075 ..1436904,1436957..1437137,1437199..1437335,1437394..1437620)


exon

Literature and cross-references BaDyPrx08
DNA ref. JGI genome:   scaffold_6 (1435529..1437620)
Cluster/Prediction ref. JGI gene:   37610 [Incorrect prediction]
Protein sequence: BaDyPrx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   570 (666)
PWM (Da):   %s   63431.58 (72007.0)  
PI (pH):   %s   6.27 (7.01) Peptide Signal:   %s   cut: 22 range:22-687
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLANTWGQSGAMRNTVDGTPIVHIAEVEVQTSVTFKWYQSEVQKQSKNALIQAQSFANNISVTKTESPTEVVYTINVFDKAGKTIPDQVTIVTCTKVINNDPLGLSNVQGDVIPGLPKAL
EYFYYFQITDLARFKQTFTTFAYSRIVTSERLVNNPPPPAQTNPNDPFLGFNVAFTSIGIARFGLDPAAIGDPAFVRGQQADAKSLGDPGVQRGSAWSPDWDAEYKANIDGIFLITAYNE
TNAQNFIKELEAAFQWAPTRSSIRKVVVLHGFPRPGKEGINDHFGYRGGGMTNPQVKGVTFTDEKPMRFTGTPVIPIGVLVMGREGDDDKDMRPEWAVDGSLIATRKLNNLVPEFDTYLL
REGPKIFPGMDPQKAADKLGARLMGRWKNGTAVEMSPDNDAPEIAADDTRVNNFEFDQSDTQQRRCPFAAHMRKSNPRNDVPPSERLKHLIRRHNMPYGPEVSDDERQNGTTAERGLHLC
IYQSSIERGFRHIQTAWYNAPQFPPGKPTEPGWDPVFGQTGNDNEHRYMSGVDPANPQAKTTFLDKFVDPRGGEYFFSPSMKTLKDYICA*

Retrieve as FASTA  
Remarks complete sequence from genomic (7 introns). Incorrect prediction from JGI (3 extra exons are predicted in 5')
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCCAACACCTGGGGACAGAGCGGCGCGATGCGCAACACTGTGGATGGCACTCCGATCGTCCACATCGCCGAGGTCGAAGTACAGACGAGTGTTACCTTCAAGTGGTACCAGTCC
GAGGTTCAGAAACAGAGCAAGAACGCGCTTATTCAAGCTCAGTCTTTTGCCAACAATATCTCGGTGACCAAG
AGGTTAGTCTTTCTTTGGCAGATTCGACGTAGACATTTGAGCTGATTG
TCCCGCAGACGGAATCTCCGACGGAGGTCGTGTACACCCCGTAAGCATCGCCTTTGATTGTCAAACATACAACCCTTACCGTCAAGCAGATCAATGTTTTCGACAAGGCTGGAAAGACCA
TTCCCGATCA
CAGTGAGTTGGTCATCTCGTCGTAGAACAGCCAGGATCTAACTGACAACTTCTCTAGAGTGACCATCGTAACATGCACCAAGGTTATCAACAACGATCCTCTCGGCCTCA
GCAACGTTCAAGGCGATGTCAT
ATGTACGTCTATTATCTCATTGGAGATCGCTTTGCCTCATGCGCTGTGTCAGTCCCGGTCTGCCCAAGGCTCTCGAATACTTCTACTACTTCCAAATC
ACCGACCTCGCCCGGTTCAAGCAGACCTTCACCACATTCGCCTACTCACGCATCGTCACCTCCGAACGTCTCGTGAACAACCCTCCCCCTCCCGCGCAAACCAACCCGAACGACCCCTTC
CTCGGTTTCAACGTCGCATTCACCAGCATCGGCATCGCGCGCTTCGGCCTCGACCCCGCTGCGATCGGCGATCCCGCGTTCGTGCGCGGCCAGCAGGCGGATGCGAAGTCGCTCGGGGAC
CCTGGCGTGCAGCGCGGCTCGGCATGGTCGCCCGACTGGGACGCAGAGTACAAGGCGAACATCGACGGGATCTTCCTCATCACGGCGTACAACGAGACGAACGCGCAGAACTTCATCAAG
GAGCTCGAGGCCGCGTTCCAGTGGGCGCCGACGCGCTCGAGCATCCGCAAGGTCGTCGTCCTCCACGGCTTCCCGCGTCCCGGCAAGGAGGGCATCAACGACCACTTTGGCTACCGCGGC
GGAGGCATGACGAACCCCCAGGTCAAGGGCGTCACGTTCACTGACGAGAAGCCGATGCGCTTCACGGGCACGCCTGTCATCCCTATTGGCGTGCTGGTCATGGGCCGCGAGGGCGATGAC
GACAAGGACATGCGGCCTGAGTGGGCTGTCGATGGGAGTTTGATCGCGACGAGGAAGCTGAACAACCTCGTCCCCGAGTTTGACACGTACCTGCTGCGCGAGGGACCCAAGATCTTCCCC
GGAATGGACCCGCAGAAGGCAGCAGACAAGCTCGGCGCGCGTCTCATGGGTCGCTGGAAGAACG
CGGTATGTCTTCTCTCTGGGCTCATGCCAATATGGTACTTACTCAGAAATACAGGC
ACTGCTGTCGAGATGTCCCCGGACAACGACGCGCCTGAGATCGCGGCGGACGACACGCGCGTGAACAACTTCGAGTTCGACCAGTCTGATACTCAGCAGCGCCGCTGCCCCTTCGCGGCG
CACATGCGCAAGTCGAATCCCCGCAATGACGTCCCGCCCTCCGAGCGGCTCAAGCACCT
CTGTACGCCCGCTTCTCTTCTCCTCACGCCATTCACTCTGCTAACACGATATCTATTCTGT
AGCATCCGGAGGCACAACATGCCCTACGGCCCCGAGGTCAGCGACGACGAGCGGCAGAACGGCACGACCGCCGAACGTGGTCTTCATCTTTGTATCTACCAGAGCAGCATCGAGCGCGGT
TTCCGGCACATCCAGACTG
TGGTGAGTCCCTCTGCTCAATACCCTCTCCCTTCACCATGCTAATTACTGCACGTCGCAGCGTGGTACAACGCGCCGCAGTTCCCGCCCGGCAAGCCGACA
GAGCCAGGCTGGGACCCCGTGTTCGGGCAGACGGGCAACGACAACGAGCACCGCTACATGAGCGGCGTGGACCCGGCGAACCCGCAGGCGAAGACGACGTTCCTGGACAAGTTCGTCGAC
CCGCGCGGCGGCGAGTACTTCTTCTCGCCGAGCATGAAGACGTTGAAGGACTACATCTGCGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCCAACACCTGGGGACAGAGCGGCGCGATGCGCAACACTGTGGATGGCACTCCGATCGTCCACATCGCCGAGGTCGAAGTACAGACGAGTGTTACCTTCAAGTGGTACCAGTCC
GAGGTTCAGAAACAGAGCAAGAACGCGCTTATTCAAGCTCAGTCTTTTGCCAACAATATCTCGGTGACCAAG
ACGGAATCTCCGACGGAGGTCGTGTACACCATCAATGTTTTCGACAAG
GCTGGAAAGACCATTCCCGATCA
AGTGACCATCGTAACATGCACCAAGGTTATCAACAACGATCCTCTCGGCCTCAGCAACGTTCAAGGCGATGTCATTCCCGGTCTGCCCAAGGCTCTC
GAATACTTCTACTACTTCCAAATCACCGACCTCGCCCGGTTCAAGCAGACCTTCACCACATTCGCCTACTCACGCATCGTCACCTCCGAACGTCTCGTGAACAACCCTCCCCCTCCCGCG
CAAACCAACCCGAACGACCCCTTCCTCGGTTTCAACGTCGCATTCACCAGCATCGGCATCGCGCGCTTCGGCCTCGACCCCGCTGCGATCGGCGATCCCGCGTTCGTGCGCGGCCAGCAG
GCGGATGCGAAGTCGCTCGGGGACCCTGGCGTGCAGCGCGGCTCGGCATGGTCGCCCGACTGGGACGCAGAGTACAAGGCGAACATCGACGGGATCTTCCTCATCACGGCGTACAACGAG
ACGAACGCGCAGAACTTCATCAAGGAGCTCGAGGCCGCGTTCCAGTGGGCGCCGACGCGCTCGAGCATCCGCAAGGTCGTCGTCCTCCACGGCTTCCCGCGTCCCGGCAAGGAGGGCATC
AACGACCACTTTGGCTACCGCGGCGGAGGCATGACGAACCCCCAGGTCAAGGGCGTCACGTTCACTGACGAGAAGCCGATGCGCTTCACGGGCACGCCTGTCATCCCTATTGGCGTGCTG
GTCATGGGCCGCGAGGGCGATGACGACAAGGACATGCGGCCTGAGTGGGCTGTCGATGGGAGTTTGATCGCGACGAGGAAGCTGAACAACCTCGTCCCCGAGTTTGACACGTACCTGCTG
CGCGAGGGACCCAAGATCTTCCCCGGAATGGACCCGCAGAAGGCAGCAGACAAGCTCGGCGCGCGTCTCATGGGTCGCTGGAAGAACG
GCACTGCTGTCGAGATGTCCCCGGACAACGAC
GCGCCTGAGATCGCGGCGGACGACACGCGCGTGAACAACTTCGAGTTCGACCAGTCTGATACTCAGCAGCGCCGCTGCCCCTTCGCGGCGCACATGCGCAAGTCGAATCCCCGCAATGAC
GTCCCGCCCTCCGAGCGGCTCAAGCACCT
CATCCGGAGGCACAACATGCCCTACGGCCCCGAGGTCAGCGACGACGAGCGGCAGAACGGCACGACCGCCGAACGTGGTCTTCATCTTTGT
ATCTACCAGAGCAGCATCGAGCGCGGTTTCCGGCACATCCAGACTG
CGTGGTACAACGCGCCGCAGTTCCCGCCCGGCAAGCCGACAGAGCCAGGCTGGGACCCCGTGTTCGGGCAGACG
GGCAACGACAACGAGCACCGCTACATGAGCGGCGTGGACCCGGCGAACCCGCAGGCGAAGACGACGTTCCTGGACAAGTTCGTCGACCCGCGCGGCGGCGAGTACTTCTTCTCGCCGAGC
ATGAAGACGTTGAAGGACTACATCTGCGCGTAG

Retrieve as FASTA