Entry information : EcamAPx10 (EcC001124.20)
Entry ID 10234
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-11 (Qiang Li)
Peroxidase information: EcamAPx10 (EcC001124.20)
Name (synonym) EcamAPx10 (EcC001124.20)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx10
start..stop
S start..stop
EglAPx10 508 0 1..248 1..248
EgrAPx10 507 0 1..248 1..248
EguAPx10 504 0 1..248 1..248
NnAPx01 455 5.64e-165 1..248 1..248
Gene structure Fichier Exons


exon

Literature and cross-references EcamAPx10 (EcC001124.20)
Literature Naksiri,C., Nakasathien,S., Yingjajaval,S. and Udomprasert,N. Cloning and Expression of Cu/Zn SOD, APX genes in Eucalyptus camaldulensis under NaCl Stress Condition. Submitted (09-JUL-2006) Center for Agricultural Biotechnology,Kasetsart University, Malaiman Road, Kamphaeng Saen, Naknorn Pathom 73140, Thailand.

mRNA ref. GenBank:   DQ839645.1 [Fragment]
Protein sequence: EcamAPx10 (EcC001124.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   262 (301)
PWM (Da):   %s   28671.6 (32392.4) Transmb domain:   %s   o15-37i
PI (pH):   %s   6.6 (9.06) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKSYPTVSEEYKKAVEKCKKKLRGLIAEKSCAPLMLRIAWHSAGTFDVKTKTGGPFGTMKHAAELSHGANSGLDVAVRLLQPIKDQFPIITYADFYLAGVVAVEVTGGPEVAFHPGREDKPQPPPEGRLPDATKGCDHLRQVFGVQMGLSDKDIVALS
GGHT
GRCHKERSGFEGTWTANPLIFDNSYFKELLSGEKKELLQLPSDKALLADPVFRPLVEKYADEDAFFEDYAEAHLKLSELGYSLNFDGHSTLTVYFS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
CDS
Send to BLAST