Entry information : EcamAPx-R (EcC049908.20)
Entry ID 10235
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamAPx-R (EcC049908.20)
Name (synonym) EcamAPx-R (EcC049908.20)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx-R
start..stop
S start..stop
EgrAPx-R 691 0 1..341 1..342
EguAPx-R 685 0 1..341 1..342
EglAPx-R 683 0 1..341 1..342
CsAPx-R 455 3.57e-162 7..341 2..335
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10235' 'join(1..229,311..392,1047..1174,1702..1772,1955..1997,2074..2170,2341..2424,2934..3055,3416..3482,3930..4029)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..229 227 N° 2 311..392 80 N° 3 1047..1174 126 N° 4 1702..1772 69
N° 5 1955..1997 41 N° 6 2074..2170 95 N° 7 2341..2424 82 N° 8 2934..3055 120
N° 9 3416..3482 65 N° 10 3930..4029 98  
join(1..229,311..392,1047..1174,1702..1772,1955..1997,2074..2170,2341..2424,2934 ..3055,3416..3482,3930..4029)


exon

Literature and cross-references EcamAPx-R (EcC049908.20)
Protein sequence: EcamAPx-R (EcC049908.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341
PWM (Da):   %s   36372.36  
PI (pH):   %s   7.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSPSTTHLSPLTCCSSSSLSSHPSSRRTKFEFPANSQRSSPSPIASRAGAIVSPSSSTPGAASSGDHAPVRGRSVAGLAATLPFLLQLRGYTEGIVADAAELDNDEYTMIKEEVRKV
VSKMKAAGVLRLVFHDAGTFEMGEN
GGMNGSIVYELERPENAGLKKPVKILEKAKGEVDAKRVSWADMIAVAGAEAVSVCGGPTIPVVLGRLDSMKPDPEGRLPEETLDALGLKQCFQRK
GL
STQELVALSGAHTLGSKGFGNPVVFDNSYYKVLLEKPWMSAGMPSMIGLPSDRALVEDNECLRWIEKYANDQNLFFKDFENAYVKLVNSGARWRS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCCCAA
CGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGTCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
ATGTTTCGCGA
ATCTGGTCGATCGCGATCTTTCGGAGCTCGCAGCTGGAGACCGCGTCTCGAGGAGGAGGAGGAAGCTCATAGCCGTGGCGGGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCG
GTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
GAGTAAGCTCGACGCTCTTTGCTTGACGAAAGTCCATGTCTTTATTGGTTGGACCGAATGAAACGGGAATTTCGAGGGAGATTGAG
ATGCTTTTGAGCTTTGGAGTTGAGCCTGCGGAGCGAAAGAAGGCTTTCCGTTTTCGTCGGTGGTCGGATTATGGGTTTTGCAGCTGCTTCTTCCGGTGATCAGTTTGTGTGTATGTGTGC
ATGCTACGGAGTTGTCCCGCCGAAATGACGCTTTTTGCTTCCTTTAAAGGACTTACTTGCCGTTTAAAGTAGAAGGTCCAGGTGTGGTCCTTCGGATTATGAGATTTTAGTTTGTGTTTC
CGGCTGGCATTTGAGGGGTAAAAACGTATCCTGGGATGGGTTTCCTGGTTGCTCATTCACTGACTTCCTGGATTTTAGTATCTGTAAGCTGTAACTGTGAATTGTCTTGTTTCTCAACAT
TGATGTTATGGACACCGTATTCAGCTGGGGAAAAACCATTTTGGGTGATGGTTTGATGGGTCGAAATTGCGATTCGGAAGTACTAATTGGATAGGGCTGTGAGTTTGATATGTTGTTTAT
CGTGACCTTGGGGCTGCATCTGTATTTGTGTTGACTTGGGGCATTTGGATATGTCCATGACTGTTGGTTTTTCATGTTCGTATATCAAAGATTAGATAATGATGAATACACGATGATAAA
GGAAGAGGTCAGAAAGGTAGTTTCCAAAATGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
AGGTATTTTACATGGACAGAAA
GTTAAAGTTCTACAAATAATGATACTCGACATCAGTAACTGTGCTCCATATCTCTGGCTACAATTTTTGAATGCCTACTAATCTATCCAAATTGTTTTATCCTCTTTTCCCCATAATTGA
ACTTTTGAGCTGAAGCTAAGATGATGCATATATTGATTTCATCTGAATTAGGGGGATATAGCTCTCATTTGCCAAAAAAGTTAGATAATCCCTGTAAATGGGCATAACTTTTTTTGTCAT
GGTGGTTTACTAAATGAACAAGGGCAATTAATTCTATGACTGTTAAAGCAACTACAGACTCTAATGGACCTTTATAAATGAATGATCAATCATAGAGAGCAGTATCATTCATACTACCTG
TATTTGTGAACTAATGGTCATGTCCGATTCTTTTATTGCATGCACATACTTCTTTTGAGTTGAAAATTTTCTGCGTCATGCTTTTTTGTCTGAGTATGGATTTCAATCCTCATATTGTAA
TTCTAATATGTTTGTGTCAATATCCAGGTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAGAGGTATGTTTTCTTTTATTACA
TCCTCAAGCTTAGCATCCATTCTGGAGATGCAACATTTCATTTCAACTAGTGTACTCCCTCATGCATTTCTGGACTGCTAGAAGTTCCTGTATCTTATGTCTAGAATAGTCAACTCCGGT
TCATCTTCAGGCTAACTCGTCAGTCATTGTGTTGTTGTTTAGATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGAGGTGATTTTTTTTAGTGTTATATTCTATATGCTG
ATGGTATGATTGTGGTGATATAGATGGAACTTTCCTCTCTCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCTGTTTGTGGAGGTCCAACTATTCCAGTTGTT
CTGGGCAGACTTGACTCAAT
ATGTAAGAAGCTATTTCCAATTCAATTACTACTGTTCTGAAGATGCGTTGATGGCAGACAAAACGTTATTTCACTCATTTCGTATTGTCAGTATTGCAAG
ATTCTTTGCATGTCTCCATCTTTGTGCATAGTCCCAAGCTAATATTGGTTTGGTTTCATTTCTTTATTGAAGGAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTT
GGGTTTAAAGCAGTGTTTTCAGAGGAAGGGCTTATC
TCGTGAGTTGCTATCCCATGTACATGTTGAATGATGCTTGCAAATTAAATGAAGTATTGTTTATTGGCTATTGCATATTGTTAT
GCATCTTACTGCTGATGGTTAAACTGTTTAATAGATATTTCGCCGGTCAACATAGAATTGGTTGTTTAGTCAACTGTGATACATTATGTTTTGCAATTTCGGGATGATAGATTCAGAGAA
AATAACAACCCCCAAAAAAGCAAGACAGCTATGCTTCCTTCTGTGGCAATAAGCATTCCTTCTTTGTTTTTCCCCTCCATTCCAAAAAAATTATGCCCTCTCTATGAGTTATTATTCTGA
CAGTATTAGCTGCATGATTACAAAAATGAAGCTTTCAAAACAGACTAAGAACATGTTTGATTGTTCCTGCTATGGACTCTGTTTGATTTTTTTTGCTATAGAAATCTGTCCTTTCAGTTT
CTTACACTATTCTGTAGTTTCTTCTCTCAGCAAAAGGAACATATTGATGTTGTCCTCATCCTCTCAGGACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTT
TTGGGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAACCCTGGATGTCTTCAG
AGGTAGCGAAAAAACATTGATGGTTCTCATGTTCTTCTGTTAGACTTTTTG
CCGGACGTAGTTACGTTGGCCTACTGGTTCTAGTTTGTTGTAGGTAAAGCATTATTTGGCATGAAATTAGTCCTGCCATCAGCTTTCTAACCCAGGAAAAGATTCTATATCTGATACTAT
GGAGTCATAATTGTGGTATTGTTTCAATAGTTAGCTCTGATCCAGTGGAAATTTATTTAGTCTGTACTGGGAAAAGGTTATTCTCACTTTTTCTGTTGCAAAAGCGACCTGAGTTTTTCT
CATCGGTAATAGTTCTCACTTAAGCTTTGCTCTTAATTATCCCTTGCTTAATTTCCTTTTTCTCAATGCAGCTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGA
GGACAATGAATGCTTAAG
AGGTTACTGATTTGATATCCCTACTATTTCCTTTTTACTAGGAAGATGGGAACAGTTTAGCCATATCTTTCTGGCCATAGACTATTATGGTGAGATATATAT
ATATCGCTGTCACTGGCACTTGTCAACTTTCAGGGATGCACCATTATTGCCACTTTTGATTTTCTTTTTCTCATGATTCTGGATAAAAGTTGCCTTTTGTCTTAATGATCCAGTTAAATC
CACATTCCATAAATATGGGAGCTGCTATATTATCATGGCCTGTTTATGCTTCTGAGAAAGCTATGTAGAATGGAAATGTGCCGACACAACAAACATAAGTAGCCAGTCTGAAGTAATTAG
TATCACCTGATTTACTATGGATATTTTGCATGAGAATGTTCTGTTTAATGTGATATTTGTTTCTTTTATTTGCTCGATCATGATACCTATATATTTTATATATACAGATGGATTGAGAAA
TATGCAAATGATCAGAATTTGTTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCCCAA
CGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGTCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
CCGTGGCGGGC
CTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCGGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
ATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAGGTA
GTTTCCAAAATGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGGCCT
GAAAATGCTGGGCTAAAAAAGCCTGTGAAG
ATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCT
GTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAAAGCAGTGTTTTCAG
AGGAAGGGCTTATC
GACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTGGGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAA
CCCTGGATGTCTTCAG
CTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACAATGAATGCTTAAGATGGATTGAGAAATATGCAAATGATCAGAATTTGTTC
TTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTG

Retrieve as FASTA