Entry information : EcamAPx01 (EcC053697.60)
Entry ID 10238
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamAPx01 (EcC053697.60)
Name (synonym) EcamAPx01 (EcC053697.60)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx01
start..stop
S start..stop
EgrAPx01 503 0 1..245 1..245
EglAPx01 498 0 1..245 1..245
EguAPx01 493 3e-180 1..245 1..245
QshAPx01 465 4e-169 1..245 1..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..119 119 N° 2 383..557 175 N° 3 651..716 66 N° 4 1936..1984 49
N° 5 2061..2143 83 N° 6 2276..2355 80 N° 7 2542..2644 103 N° 8 2765..2827 63
join(1..119,383..557,651..716,1936..1984,2061..2143,2276..2355,2542..2644,2765.. 2827)


exon

Literature and cross-references EcamAPx01 (EcC053697.60)
Protein sequence: EcamAPx01 (EcC053697.60)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   245 (301)
PWM (Da):   %s   26966.89 (32392.4)  
PI (pH):   %s   6.68 (9.06) Peptide Signal:   %s   cut: 23 range:23-323
Sequence 286
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKRYPNVSEEYRKAAAKCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVQTKTGGPFGTIRHSAELAHEANNGLDIAVRLLEPIKAQFPILSYADFYQLAGVVAVEITGGPEIPFHPGRPDKNEPPPEGRLPEATKGSDHLRQVFGHMGLSDKDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGDKEGLIKLPSDKALIEDPVFRPLVEKYAADEDAFFADYEEAHLKLSELG

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCAAGCGTTACCCGAACGTCAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGTGGACTCATCGCCGAGAAGCACTGCGCTCCCATCGTCCTCCGACTGGCGT
AAGTAATCTCACGATCTCCGCTAGTTGCTTGCTTCGGCACCTGTTGATGATCCGGTCTAGAAGTTTCGAGTTCGTAGACGAATGCTTGAACTCACAGATGGACCGATTTCGACCGTTTGA
CAATCGAACCATGTGCATTTTGTCCGGCTTAAGCATCGCTCCGTGGATAGAGAGTTTTGTTTCCGCATGGATGCAGCTGGCGACTGTAGATTTGTCGGCGATTGTTTGATTTTTCTGGTT
CGGTGTTCGTTGGCGTCGCAGATGGCACTCCGCCGGTACCTTCGACGTGCAGACGAAGACGGGAGGCCCCTTTGGGACGATCAGGCACTCTGCCGAGCTCGCTCACGAAGCGAACAACGG
ATTGGATATCGCCGTCCGGCTTCTGGAGCCGATCAAGGCACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAG
GTATGACTGCCGAATGCAATCACAACCAAAATTGAATTAAAGTA
ATCAAACTACGAAGCACGACGCTGAAATCTCGATATGTTGTATTGGAAGTTGGCTGGGGTTGTTGCTGTTGAAATAACTGGAGGGCCCGAGATTCCTTTCCACCCTGGTAGACCGGTAAG
TTGATTTTCATCTTTGTTCCAAAACTCTCTATTCGGCCCCTAAAGTAAGGATGAGCTAATTATTCATTATCAATTTAGGAGCTTTCTTAAGTGGTTTGATGAGGTGTTTAGCTGCATGAC
CCTGCTGTTGTTCTTTTCTCAAACTAGAATTAAAAGAGATATGTGCCTGCTGGGATTCTGTTGCTGTTCAGCCTGAATAAACTATTCTAGCTCTTCCCATAGAAACTTTGTAATCTTTGA
ATGAATGGCAGCTACTGTCGGTAGGATTTTGCGAGAATCTAAATAGTAGGAAAGGGGGACACTAAGAACTTCATTGACAAGCATAGAAGGAAGATTCGCTTAGGTACGTAAGAGAGTTGA
TAGTATCCCAGGAAGCAAACAGATACGAGTTAAAAATCTTCTAGTACTGGAAGTTCGATAACTTGTGAATGGTAATCATCCTGAGAAACCAACTCCTGTGAAATGTTTATGAGCGAGCTA
GTTGATAATCGGAAATTGACCTAATTATAATCGGAAATTCAGTGAATAGCTTCTAGAAGTATAAGCACGATGTCCCTGTCTTCTTGTCTATTGAACTAATGCTGACATTGAATATCGGAG
TCCTCTGGAGTTATTAAAGACGATGTCAAAATGAAAATTGTGTGGGGATCTCCAGATAATTGGATAAAATTGTTTTGATATGTGCGGTTTCACTCTCAGAATTGATGATGATTGATGTGT
TTCTCGGTTGATGATTGATGTGTATCGTACCTCCTATTTAGCCTATGAATGTCCCTTCTGGTATGCTCACTCTGTTCTCTCTCTTGACGAAAAGTGGGGTTGGAGGTTTCTTGGTTGCTA
TAGACAAACAGAATAAGAAATGATTCCTCTCGTTGAAACTCTGGCAACTATACTTAGTTTGTCTGACAACCCGACTTGAGTGATGCAGGTTATGCTTAGTATGTTACTTTGAAATTTCAA
ATCCTTTAGCTTAATATCGGCCTTCTCATTATACTTTCTTACAACGCAATGGTCAATCCTGTTTGAAATATTGTTTGTTGAGATAATATACTGTTTTCTTGGTGTATTAGTTAGTAGGCT
ATGTAATACTTGGCATCATAATTCATAGAAACTTGAATCGCTTATTCCCACGGTTCAGATAAAAGCAAAAGTTCTCTAACATATATTAGATATGAAGGTATCAATAAATCTCTGATAAAT
TACATTTTGCTCAGGACAAAAATGAACCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAGGTTAGTTTGCTTGCAGTAAAGTGCGAGAAGATTATTACTGGTGTCTATGCTTTGACA
AGTAAACCACTCATTTCAGGTTCCGACCATCTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCGTTGCCCTATCTGGTGGGCACACTCTGGTAAGTCGATTAGTCACA
GTTAAGTTTCACTCAGAATTACTTATTTGCTAAGAATTAAGTCCATGTTGCTGTACAGTTTTGGAGACCTCGTGAATTCTTTATATTAATGCTCCCTTGCGCTCCTTTCTACAGGGCAGA
TGCCACAAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTTAA
GTAAGAATAATCTTGCTCTATTCTTCTATAGTCAACTCAGCAGTTA
TATATCACCTGCTTAAACTTTGTAACCAGCTTCTTGACTTGCTTAATTAGCGCAGAGAAAAAAGCATGGTTTTGACTTGCTTATGCTGTCGGTCCCTAATGCTGACAATTTTGATATCTG
TGGATGTTCCTATGAAACAGGGAACTCCTCAGCGGAGACAAGGAAGGTCTGATCAAGCTACCATCTGACAAGGCTCTTATTGAGGATCCCGTCTTTCGTCCTCTTGTTGAGAAGTACGCT
GCG
GTATGTTCGCAACCCAATGTCCTATCGTCATTTCAGAGAATTTTGCGGGGCCATCGATGGTGGAAACAATTTGTTTTTTTGGGTGATCGTCTAATAGGGAGGCTGCTTTGGATGTTT
CAGGACGAGGATGCATTCTTCGCGGATTATGAAGAAGCTCATCTGAAGCTGTCAGAGCTAGGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCAAGCGTTACCCGAACGTCAGCGAGGAGTACCGGAAAGCCGCCGCGAAGTGCAAGAGGAAGCTCCGTGGACTCATCGCCGAGAAGCACTGCGCTCCCATCGTCCTCCGACTGGCAT
GGCACTCCGCCGGTACCTTCGACGTGCAGACGAAGACGGGAGGCCCCTTTGGGACGATCAGGCACTCTGCCGAGCTCGCTCACGAAGCGAACAACGGATTGGATATCGCCGTCCGGCTTC
TGGAGCCGATCAAGGCACAGTTCCCGATCCTGTCCTACGCGGACTTCTACCAG
TTGGCTGGGGTTGTTGCTGTTGAAATAACTGGAGGGCCCGAGATTCCTTTCCACCCTGGTAGACCGG
ACAAAAATGAACCTCCCCCTGAAGGCCGGTTGCCTGAAGCTACAAAAG
GTTCCGACCATCTAAGACAAGTCTTTGGCCACATGGGTCTTAGCGACAAAGATATCGTTGCCCTATCTGGTG
GGCACACTCTG
GGCAGATGCCACAAGGAACGCTCTGGATTTGAAGGACCCTGGACTACCAACCCTCTCATTTTTGACAACTCCTACTTTAAGGAACTCCTCAGCGGAGACAAGGAAGGTC
TGATCAAGCTACCATCTGACAAGGCTCTTATTGAGGATCCCGTCTTTCGTCCTCTTGTTGAGAAGTACGCTGCG
GACGAGGATGCATTCTTCGCGGATTATGAAGAAGCTCATCTGAAGC
TGTCAGAGCTAGGGTGA

Retrieve as FASTA