Entry information : EcamAPx11 (EcS769027.10)
Entry ID 10246
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status partial
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: EcamAPx11 (EcS769027.10)
Name (synonym) EcamAPx11 (EcS769027.10)
Class Ascorbate peroxidase     [Orthogroup: APx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx11
start..stop
S start..stop
EgrAPx11 491 3.17e-179 1..244 16..259
EguAPx11 485 8.49e-177 1..244 16..259
EglAPx11 450 5.79e-163 1..243 13..255
CroAPx03 390 8.66e-139 1..232 18..247
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10246' 'join(1..65,273..397,504..553,1084..1149,1230..1278,1428..1516,1621..1700,1786..1888,2050..2154)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..65 63 N° 2 273..397 123 N° 3 504..553 48 N° 4 1084..1149 64
N° 5 1230..1278 47 N° 6 1428..1516 87 N° 7 1621..1700 78 N° 8 1786..1888 101
N° 9 2050..2154 103  
join(1..65,273..397,504..553,1084..1149,1230..1278,1428..1516,1621..1700,1786..1 888,2050..2154)


exon

Literature and cross-references EcamAPx11 (EcS769027.10)
Protein sequence: EcamAPx11 (EcS769027.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244 (303)
PWM (Da):   %s   26764.62 (32190.8)  
PI (pH):   %s   5.05 (4.78) Peptide Signal:   %s   cut: 27 range:27-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ARRLLRALILSKQCAPIMLRLAWHDAGTYDATTETGGPNGSIRNEAELan>RHGSNSGLEIAVDLEGVKASCPKISYADLYLAGVVAVEITGGPSVRFVPGRKDSVESPEEGRLPDAVKGEDASHLREVFYRMGLSDKDIVALSGGHTGRAHIDRSGFDGPWTK
EPLKFDNSYF
VELLKGYSPGLLQLPSDRVLVEDTEFLPYVELYADEEAFFKDYARSHKKLSELGFTPDYMGLMLAKLKL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. (5' end is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGCGTAAAGATTCTCGTACCCTTTCTCTTCTTTCTTATTATACCTTTCTTTTTGGC
GAAGTAGTGTCTGTTTGAAGGTTGGTGAGTGATGAAACTTGTCGGATTGCGAGCGACCGGGGGCACATACGCGGTGCTTTGTAGTGTTTCGCGTAGATTGCCTGTTTAAGACTTCTCAAA
TAATGTTGGCGCATGATGGTCATGAAATCTGCAGGTGGCATGATGCGGGCACTTATGATGCTACAACAGAGACGGGAGGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATG
GCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
CGGTGGGCTTCTGCGGCTTAGCACATATAACTTACCACATTCACAAGTTCATTCTACATTTTCTAGGAACGTCTTTCTTCA
AATCTTTCTACTTCTATTTTGTTTCAGAAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAGAGGTTACTGTCTTTTTCATGAATTTTTGCCTTCTTGGTTAAAA
GTTAAATGATCTTCTCAGTTGGTGACATGATAAAGAAATATGTAAACCAGCACATAGGTCACAGTGTGCTGCACATGGAAAGAAATCTTTGAGACTATTGATGAACCTGTACTGCACAAA
TTCCATAGCCTGATAGTTTCAAACTTTGCTACTCTTATCTGGGTTTGATGTTAGCTACAGAGAAATCTTGCAGATGTGGTTTCTAAGATGTTAAGGGTGTTATCTGACATTCCATGTGAG
GAGACTTACCCATGCTTACTTTGGATGAAGACGTCGTGGCTAGTTATTTTCTGGCTGTGTTGACTATTTTGCTCGCATTAATCATTATATCTCCAGGGACAGTCTCCAGTTGTTTAATAG
CTTTGTGTTGAATTGCTTTTTATGGTAACTGATGAGCAGCTAGAGCAGTCTATGTAAAAATTCAAGTTCAAGAGGCAAGAATTTTCAGATGTTGTGAACTCACAAGTTCAGGCATAATTT
GTTTTTCAGCTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGAGGTAAAATTGGCAGAAAGAATTCTTGAGGCCTAATGAAACATGC
ATCATCACTTATATCGACCAAGTCATTTCTATATTAGGATTCTGTGGAGTCTCCAGAGGAAGGACGTCTTCCAGATGCTGTTAAAGAGGTACGTATCACTAAAACTTTAAGTTGAACAAT
TCTTAAGTGGTTTGAACTGATGACACCCATATGAAAATGATACCAGCTTGTATATTAGCAGAGAACCTCAGACTTTCCACAATGCTCTTAATGTAGTCCTTGTTCATCTTAATACAGGTG
AAGATGCTTCGCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTTG
TGGTAGATATTTCAGAAGCCCTAAACCGCTTCAT
ACGAGTCCTTCCCTGCGGTACCAGCAGTTTGTGCATATTCCGATTTCTTCCTTTTCTTCTCTGAATTTTCAGGGAAGGGCACATATAGATAGATCAGGCTTTGATGGACCCTGGACCAAG
GAACCCCTTAAGTTCGATAATTCTTATTTTGT
GTGTAAGAGATGATCACACTTCGATGCAATTCTCTCTATTCAAACTCTACTTCCATCAGATGAGCTTTCTGCACAATGCTTGCGCAGG
GAACTTCTGAAAGGATACTCACCAGGACTTCTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCTTCCCTATGTCGAGCTATATGCTGAG
AGGTACTATCCATCTAAA
GGGGGGCTTTGGAACATCTTGTCTTTTAAGTCGTGCTGAAAGAGGCAGTACATGTCCCCAATGGAAGTTCATCATTCTTTGTGCTAGTTTCTTCTTTGTGAGAGAGTTTTCTTTATGTTC
TTTTTGGTTTCCGAGCGACATGCAGGATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTGTCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCAAA
GCTCAAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTGGCATGATGCGGGCACTTATGATGCTACAACAGAGACGGGAGGGCCTAATGGC
TCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
AAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAG
CTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGATTCTGTGGAGTCTCCAGAGGAAGGACGTCTTCCAGATGCTGTTAAAGGTGAA
GATGCTTCGCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTTG
GGAAGGGCACATATAGATAGATCAGGCTTTGATGGA
CCCTGGACCAAGGAACCCCTTAAGTTCGATAATTCTTATTTTGT
GGAACTTCTGAAAGGATACTCACCAGGACTTCTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTT
CTTCCCTATGTCGAGCTATATGCTGAG
GATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTGTCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCA
AAGCTCAAATTG

Retrieve as FASTA