Entry information : EcamPrx105 (EcC041066.20)
Entry ID 10271
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx105 (EcC041066.20)
Name (synonym) EcamPrx105 (EcC041066.20)
Class Class III peroxidase    [Orthogroup: Prx086]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx105
start..stop
S start..stop
EgrPrx105 699 0 1..339 1..339
EguPrx105 690 0 1..339 1..339
EglPrx105 655 0 1..339 1..339
EgrPrx109 636 0 1..339 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..237 237 N° 2 404..595 192 N° 3 748..913 166 N° 4 1067..1488 422
join(1..237,404..595,748..913,1067..1488)


exon

Literature and cross-references EcamPrx105 (EcC041066.20)
Protein sequence: EcamPrx105 (EcC041066.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (309)
PWM (Da):   %s   36823.57 (33622.8)  
PI (pH):   %s   5.16 (4.78) Peptide Signal:   %s   cut: 31 range:31-339
Sequence 380
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALYHPRILTMQFLAAIAFISGIIRSGASDPPLTLDYYASSCPNVLEIIRQEMEHEVLSDPHNAALVLRLHFHDCFVQGCDGSVLLDDTVMLRGEKTASPNINSLKGFEIIDRIKSKVESQCPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSRSASYELANTNIPTPNQGLISIIYKFLKLGLSVTDTVALSGAHTIGVARCENFRARIYGDYELTSGGSPLSEVHLSQLKSKCPAAGGGDNNTAPLDYETPNTFDNSYYHLLLNGEGLLNSDQELYSSALALQTKQLVEQYALDVAAFFQQFSVSMVKMGNLTNPDSFLNGEVRKSCRFINA

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCAT
CCTCATGCCCAAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAATGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GTGC
ATTGCTTATATCGTAACTCTGCAATTTTATATTCTGTTGTGTTAAATTGAACATGTACTTTGGGATGAAAGTATGCGTTAGTAGTGACAACCATCTTGAAGCATGGATCAATCTGCAAAG
GGAGAGTGTTTTCTGAATGTTTTGGATGCGGTGTTTTATTAGGGATGCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCCCCAAATATAAACTCT
CTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAATCCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTATAG
ATTGTCCCCTCCCTTTCTCTCTGAATTCCTCATTGACATGTCAAATAATGTTCCGAATTATAACTTCTGTAGTTATTACTTGCTAACCGAGGAGAAATATCAGAAAATCAATGTGACTGA
TATCGATTCTCTTTCGTACTTGTTAGGTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGCGCAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATC
AAGGCCTCATTTCCATCATTTACAAGTTCCTTAAACTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GTAATTATTAAGTTCCTACTCCTTTTTAAGTGTTCGATCGAATTACTC
ACCCAAGGTGCGCTTATTGCCACAGAAGAAAGCGCGCTGATCAAGACTTGTATAGTACATTGCATGAGCCTTTCCTTTTAACTATATGCACATGTGAATCGCTAGGGGCTCACACGATTG
GCGTGGCACGCTGTGAGAACTTCCGGGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTCAGCCAATTGAAGTCCAAATGCCCGGCCGCAG
GAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAGGAACTATACT
CAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACGAATCCGGATA
GCTTTCTCAATGGGGAAGTGAGGAAGAGTTGCAGATTCATCAATGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCTTTATATCATCCAAGAATCCTCACGATGCAGTTCTTGGCAGCCATCGCCTTCATTTCTGGCATTATACGTTCCGGTGCAAGCGACCCTCCACTGACGCTCGATTACTATGCAT
CCTCATGCCCAAACGTGCTCGAAATCATCCGCCAAGAAATGGAACATGAGGTGCTCTCTGATCCGCATAATGCTGCTTTAGTACTCCGTCTACACTTCCACGACTGCTTCGTTCAG
GGAT
GCGACGGTTCGGTCCTGTTGGATGATACGGTCATGCTACGAGGGGAGAAGACAGCTTCCCCAAATATAAACTCTCTAAAAGGTTTTGAAATCATCGATAGGATCAAGAGCAAGGTTGAAT
CCCAATGCCCTGGAATTGTCTCTTGCGCTGATATATTGACCATTGCTGCTAGAGATGCTGTCATTCTG
GTGGGCGGACCGTATTGGGATGTTCCGGTGGGGAGAAAAGACTCGAGAAGCG
CAAGCTACGAGCTTGCAAACACCAATATTCCTACTCCGAATCAAGGCCTCATTTCCATCATTTACAAGTTCCTTAAACTCGGCCTCTCTGTCACCGACACCGTCGCACTTTCCG
GGGCTC
ACACGATTGGCGTGGCACGCTGTGAGAACTTCCGGGCCAGAATATATGGGGACTACGAATTGACGTCGGGCGGTAGTCCATTATCTGAAGTGCACCTCAGCCAATTGAAGTCCAAATGCC
CGGCCGCAGGAGGGGGAGATAACAACACCGCGCCTTTGGACTACGAAACGCCCAACACGTTCGACAACTCCTACTACCATTTGCTCCTGAATGGAGAGGGATTGCTAAATTCTGACCAGG
AACTATACTCAAGTGCATTGGCCCTTCAGACCAAGCAGCTTGTGGAACAGTATGCACTTGACGTGGCAGCCTTCTTTCAGCAGTTCTCCGTTTCCATGGTAAAGATGGGGAACCTCACGA
ATCCGGATAGCTTTCTCAATGGGGAAGTGAGGAAGAGTTGCAGATTCATCAATGCT

Retrieve as FASTA