Entry information : EcamPrx61 ( EcC044360.10)
Entry ID 10273
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-23 (Christophe Dunand)
Peroxidase information: EcamPrx61 ( EcC044360.10)
Name (synonym) EcamPrx61 ( EcC044360.10)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx61
start..stop
S start..stop
EgrPrx61 683 0 1..329 1..329
EguPrx61 678 0 1..329 1..329
EglPrx61 666 0 1..329 1..329
PtPrx15 501 1.64e-180 2..326 3..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10273' 'join(1..201,643..1428)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..201 199 N° 2 643..1428 784  
join(1..201,643..1428)


exon

Literature and cross-references EcamPrx61 ( EcC044360.10)
Protein sequence: EcamPrx61 ( EcC044360.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (310)
PWM (Da):   %s   36437.36 (34232.2)  
PI (pH):   %s   8.19 (8.18) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPFHLLLLFLVFFNIATSSESKLTLDYYKKTCPGLQQTIRQVIT
NKQIASSTTAAATLRLFFHDCM
VNGCDGSILISSNAFNTAERDADINLSLPGDGFEVVTRAKTALELECPDIVSCADILALAARDLVTMVGGPYYDVRLGRKDGFVSKASEAEAAMPKPTMPLSQIIKIFETRGLSVQEMVA
LTGAHTIGFTHCKEFSHRLYNFSKKSDYDPTLYPKYAEGLRKLCENYTKDPTMSAFNDVMTPNKFDNMYYKNLQKGLGLLASDQAMAVDGRTKPYVDLYAGNQTAFFQAFARAIEKVSVY
QVKTGRKGEVRHRCDAFNSLQT

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCCGGCCTCCAACAAACCATC
CGACAAGTCATCACCAACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
TGGTAATCGTAGTGAATGAATGTCCCATTATGTTTTAGG
TACACAAATTCTAATTTGCGAAATCCGTGTTGACGAGTGTACATCGGTTCGACTGCGGTAGTATCATGTCGGGCTACGTGTTAAGGTTTTCCAAGCCTTCCCGTCCAATTTAGATTCATC
TTGATTGAGGGACTAGATTGATGCTTTGCCAATGTAACGATGCATGGAGAAAAGGATCTCGACAGCATTATGCACAAAATGCAACTATCAATACGTCGCGGGAAATTTGTACTAAATACA
AAATAAGGGATCTTGAAAAATATTAGGATGTCTTTCTGTAGAATACGAGACTCGATCTGCAAGTTATTGATGTATCGATGAGAAGTATTTTGATTTGGAGTTAGCCCTAACGGTGTTTAT
ATTCGATTAGTATTGAACTATGATGAAACTGAATATCCCAACAGGTAAACGGTTGCGACGGCTCCATCCTCATCTCCTCCAACGCGTTCAACACTGCTGAACGCGATGCCGACATCAACC
TCTCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGTGCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGA
CCATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGAAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCCGCCATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCA
AAATCTTCGAGACGCGAGGGCTCAGCGTGCAAGAGATGGTGGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAGGAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAAT
CGGACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATGTCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCG
ACAACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGGCCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAGCCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCT
TCTTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGGTGCGACGCCTTCAACTCCCTCCAGACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCCGGCCTCCAACAAACCATC
CGACAAGTCATCACCAACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
GTAAACGGTTGCGACGGCTCCATCCTCATCTCCTCCAAC
GCGTTCAACACTGCTGAACGCGATGCCGACATCAACCTCTCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGT
GCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGACCATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGAAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCCGCC
ATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCAAAATCTTCGAGACGCGAGGGCTCAGCGTGCAAGAGATGGTGGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAG
GAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAATCGGACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATG
TCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCGACAACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGGCCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAG
CCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCTTCTTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGG
TGCGACGCCTTCAACTCCCTCCAGACT

Retrieve as FASTA