Entry information : EcamPrx48 (EcC050920.20)
Entry ID 10294
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx48 (EcC050920.20)
Name (synonym) EcamPrx48 (EcC050920.20)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx48
start..stop
S start..stop
EgrPrx48 649 0 1..322 1..322
EglPrx48 617 0 1..322 1..322
EguPrx48 612 0 2..322 1..321
PpePrx32 463 6e-166 22..322 21..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 586..1347 762  
join(1..204,586..1347)


exon

Literature and cross-references EcamPrx48 (EcC050920.20)
Protein sequence: EcamPrx48 (EcC050920.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   34400.41 (32075.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.14 (7.70) Peptide Signal:   %s   cut: 22 range:22-322
Sequence 363
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVCKMKNVVLVLLFVLPLTLADLRVGFYNSTCPQAESIVRQVIQKRFGADRSITAALLRMHFHDCFVRGCEASILIDSTAKKPSEKTAGPNFSVRGYDIIDEAKKSLEAACPSTVSCADIITLATRDSVFLAGGPSYNVPTGRRDGLVSNPDEVDLPGPSLSVSGALQAFTVKGFTLTEMVTLLGGHSVGVAHCGLFEDRLSNFQGTGAPDPTMDSSLVAKLKGICGNSTSNDPTAFLDQSTSFIMDNQFYKQIMQKKGVLQIDQELAVDKSSAGIVSRFASDANSFKKSFASAMVKMGNVQVLTGNAGEIRRNCRAFNQPK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGTGCAAGATGAAGAACGTAGTACTCGTGCTTCTCTTCGTTCTTCCCCTCACGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGGC
AAGTCATTCAGAAGAGATTCGGAGCTGATCGATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GTAAGTTACCGGCGTCTTCTGCCGAATGAACACGTAA
CTTTGATATGTTATAGATTAAGGAAAATGACAAGGTTAACTAAGTAGCTAGTTTATATATCAATATGTTAATGCGATGTGACATGCTTTATTGTTACCATTCATCCAGAGTCTAGTAGCT
AACGCAGCAATTCATATATCAATTCCCTAATAACTAGCATTAGTCTTAATCATATTGAGTCGCATCAACTCAAACCTGTTAAAGCTCAACAGACATTATGTGAAAATTACTAGACGTTTA
AGAACAATGATGTTGTGCTCGATTGATGGTGTCAGATAGGTCTGTCACCTCCATTTAACCATAAAAGCATGCCGCTCACATTTTTTTGCCTCGTTTTTTTATAGGGCTGTGAGGCATCCA
TCCTCATCGACTCCACCGCCAAGAAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTTCGA
CCGTCTCTTGCGCTGACATCATCACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCCACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATGAAG
TGGACTTGCCGGGACCCTCATTATCGGTATCTGGGGCGCTACAAGCTTTCACGGTTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTCACT
GTGGCTTGTTCGAAGACCGGCTTTCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACTCGACAAGCAACGACC
CCACCGCGTTTTTGGACCAAAGCACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTAGCG
CCGGCATTGTTTCTAGGTTCGCGTCAGACGCGAACAGTTTCAAGAAGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGAGGA
ATTGCCGGGCCTTCAATCAGCCCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTGTGCAAGATGAAGAACGTAGTACTCGTGCTTCTCTTCGTTCTTCCCCTCACGTTGGCTGATTTGAGGGTTGGCTTCTACAATTCCACCTGCCCGCAAGCAGAATCCATCGTGAGGC
AAGTCATTCAGAAGAGATTCGGAGCTGATCGATCAATCACTGCCGCCTTGCTTCGCATGCATTTTCACGATTGTTTCGTGAGG
GGCTGTGAGGCATCCATCCTCATCGACTCCACCGCCA
AGAAGCCATCGGAGAAAACCGCTGGGCCGAACTTCTCTGTGCGAGGATATGACATCATTGATGAAGCCAAGAAGAGCCTTGAAGCCGCATGCCCTTCGACCGTCTCTTGCGCTGACATCA
TCACGCTGGCAACACGAGACTCCGTGTTCCTCGCCGGAGGGCCCAGCTACAATGTCCCCACCGGAAGGCGGGACGGTCTGGTTTCAAACCCGGATGAAGTGGACTTGCCGGGACCCTCAT
TATCGGTATCTGGGGCGCTACAAGCTTTCACGGTTAAAGGGTTTACACTCACTGAAATGGTGACTCTTCTGGGCGGCCACTCCGTCGGAGTCGCTCACTGTGGCTTGTTCGAAGACCGGC
TTTCGAATTTCCAAGGCACTGGAGCTCCAGATCCAACGATGGACTCGAGCTTGGTCGCGAAGCTAAAGGGCATCTGCGGGAACTCGACAAGCAACGACCCCACCGCGTTTTTGGACCAAA
GCACGTCGTTCATTATGGATAACCAGTTCTACAAACAAATTATGCAGAAGAAAGGGGTGTTACAAATCGACCAGGAGCTCGCCGTGGACAAATCTAGCGCCGGCATTGTTTCTAGGTTCG
CGTCAGACGCGAACAGTTTCAAGAAGAGCTTCGCTAGTGCGATGGTGAAGATGGGAAATGTCCAGGTTCTCACTGGGAATGCCGGAGAGATAAGGAGGAATTGCCGGGCCTTCAATCAGC
CCAAG

Retrieve as FASTA