1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx[P]47 ( EcC050920.30)
Entry ID 10295
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-21 (Christophe Dunand)
Peroxidase information: EcamPrx[P]47 ( EcC050920.30)
Name (synonym) EcamPrx[P]47 ( EcC050920.30)
Class Class III peroxidase    [Orthogroup: Prx297]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]47
start..stop		 S start..stop
EgrPrx[P]47 461 5.12e-165 1..316 1..323
EglPrx[P]47 461 6.01e-165 1..316 1..322
EguPrx[P]47 434 1.59e-154 1..316 1..323
EglPrx48 287 1.58e-96 19..307 21..319
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx[P]47 ( EcC050920.30)
Protein sequence: EcamPrx[P]47 ( EcC050920.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (296)
PWM (Da):   %s   34202.58 (32082.4) Transmb domain:   %s   o5-27i
PI (pH):   %s   10.03 (9.90) Peptide Signal:   %s   cut: 20 range:20-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMITIFLGFIFLLPQGLGNLKVGFYNFICPRAESIVHQVVRSRFQADQSITAALLRMHFHECFVRGCDASILIDSTDSNPLKKSAAPNLTVRGFEIIDEAKKNIEASCPSMVSCADIAT
LAxTRYAVFLAGGPSYDVATGRRDGIISARDEVNLPGPTFSQQKDSLLPKWSFSWVDTPLESLTTRPYLRFMxGTGAPDRSMDPSLIMKLKVTCGASSSSDPTVSLDQSTPSSSITSSIA
RFLRREGYCKLIRSSLLINRPRQSSLSTGWTQNGFRLSFAIAMVKMSNVGVLTGNAG*IGKNCRVFQLARMLRQLG

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (frame shift and stop in frame). Incorrect prediction from kazusa (5' end is missing which has been completed manully). The same with EcC039920.40 (Removed) at DNA level.
DNA ►
Send to BLAST
CDS►
Send to BLAST