1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx115 ( EcC054713.70)
Entry ID 10322
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EcamPrx115 ( EcC054713.70)
Name (synonym) EcamPrx115 ( EcC054713.70)
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx115
start..stop		 S start..stop
EguPrx115 662 0 1..322 1..322
EgrPrx115 660 0 1..322 1..322
EglPrx115 656 0 1..322 1..322
EgrPrx116 600 0 1..322 1..321
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx115 ( EcC054713.70)
Protein sequence: EcamPrx115 ( EcC054713.70)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34545.17 (32064.9)  
PI (pH):   %s   7.31 (6.97) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSFSKAVLTLACVVLLVGGTSAQLSIYHYAETCPQLCPTVK
SIVQAEIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDTPTFTGEKNAAPNRNSLRGFEVVDKIKAAVENVCPGVVSCADLLAIISRDAVEILGGPGWDVKLGRRDARTASQAAANNSIPPPTDSLNALISGFQNHGLSQKDLVALYG
AHTVGQARCTNFRARIYNESNIDSSFAQAMKSNCPSVNGVGDNNLDGLDFQSATSFDNTYYINLMRKRGLLHSDQQLFNGGSTDSLIRTYAQSQETFFKDFVASMINMGDIKPLTGSNGE
IRKNCRRI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from kazusa.
DNA ►
Send to BLAST
CDS►
Send to BLAST