Entry information : OsPrx24 (LOC_Os02g06630)
Entry ID 1034
Creation 2006-08-24 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-13 (Achraf Jemmat)
Peroxidase information: OsPrx24 (LOC_Os02g06630)
Name (synonym) OsPrx24 (LOC_Os02g06630)
Class Class III peroxidase    [Orthogroup: Prx147]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx24
start..stop
S start..stop
SiPrx71 486 4.28e-174 23..346 20..344
TaPrx129-1D 484 1.85e-173 36..346 38..344
TaPrx129-1A 481 2.99e-172 16..346 1..327
ZmPrx27 480 9.89e-172 12..347 4..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1034' 'join(1..252,347..541,623..784,2127..2561)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..252 250 N° 2 347..541 193 N° 3 623..784 160 N° 4 2127..2561 433
join(1..252,347..541,623..784,2127..2561)


exon

Literature and cross-references OsPrx24 (LOC_Os02g06630)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004).
Protein ref. UniProtKB:   Q5U1R9
DNA ref. GenBank:   55700914
Protein sequence: OsPrx24 (LOC_Os02g06630)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348
PWM (Da):   %s   36107.41 Transmb domain:   %s   i12-34o
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTRRRRAGGVPMAVIRLGVAAIVVLGAGVIGGARAQLRMGFYDESCPAAERIVGEYVRQHVGRVPTVAAALLRLHYHDCFVRGCDASILLNSTGNGGAAEKDAAPNQTLRGFDLIDRV
KGLVEAACPGVVSCADVLALAARDAVAAIGGPSWRVPTGRRDGTVSSMQEALAEIPSPAMSFPELAGLFATKGLSVRDLVWLSGAHTIGIAHCSSFADRLYNGGGGAGNANGNNTDPPPL
DAAYAANLRERKCRTAGDGVVEMDPGSHLTFDLGYYRAVLRHRGLLRSDAALVTDAAARADIAGAVASPPEVFFQVFGRSMATLGAVQVKTGSDGEIRRNCAVVNSGH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 3 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
CGGACACCAT CGACAACGTC AAGGCCAAGA TCCAGGACAA GGAGGGCATC CCCCCAGACC AGCAGCGTCT CATCTTCGCC GGCAAGCAGC TCGAGGATGG CCGCACCCTC GCCGACTACA  ACATCCAGAA GGAGTCTACC CTCCACCTGG TGCTTCGTCT CCGTGGTGGT ATGCAGATCT TCGTGAAGAC CTTGACTGGG AAGACCATCA CTTTGGAGGT TGAGAGCTCC GACACCATTG  ATAATGTGAA GGCCAAGATC CAGGACAAGG AGGGGATTCC CCCAGACCAG CAGCGTCTGA TCTTCGCTGG CAAGCAGCTG GAGGATGGAC GCACCCTCGC CGACTACAAC ATCCAGAAGG  AGTCCACCCT CCACCTGGTG CTCCGCCTCC GTGGTGGTCA GTAATCAGCC AGTTTGGTGG AGCTGCCGAT GTGCCTGGTC GTCCCGAGCC TCTGTTCGTC AAGTATTTGT GGTGCTGATG  TCTACTTGTG TCTGGTTTAA TGGACCATCG AGTCCGTATG ATATGTTAGT TTTATGAAAC AGTTTCCTGT GGGACAGCAG TATGCTTTAT GAATAAGTTG GATTTGAACC TAAATATGTG  CTCAATTTGC TCATTTGCAT CTCATTCCTG TTGATGTTTT ATCTGAGTTG CAAGTTTGAA AATGCTGCAT ATTCTTATTA AATCGTCATT TACTTTTATC TTAATGAGCT TTGCAATGGC  CTATGGGATA TAAAAGATTA TTCTGGAGGG AAGTGATGCT GGAAGGACTA TGCTGTCCTG ATTTATATTT GGAGCCACTA TGAGCATTTG GGCTTTCTTT TCAGAACGCT GTAGGCGTGT  GTTGAAATCT TTGCGACATT CAATTTGATA TATGATTCGA GGTAATTGGG CTTTAATTTG TCATCTCATG TAACATCTTT TTGTTTCTTC GCTGCTTGAT TTCTCTATTT CGTAGCATTG  GAAGATAATA GTAGAATGAT GATATACTCC AATACTTGCA ATTTCAAAAC CGTTAGAAAG AAAGGAAAAT CACGGCTAGG GGAAAAATTC TCTCTGATGC GTGCATCACC AAAATCTGAT  TGATTGACAT AAGCATTGGA ACACAAATAG AAGATGGAGA GGTGGACATG TTTCCGAGAC ATAGCATTTG AGCTCACATT GTTTTTGATC CGTGGCTGTG CCATACGCGA TAATTTACTA  AACTTTCCCT TGCCCCTTGG TAATATAAAG CTTATAATGT ATACACCGAA ATTGAAAAAC GTATTAGTTC ACTCTTCTTC CTTTTTCTCA GCAAAGCGTG TTCATCAATT TTATTCCACA  TGAATGTGAT TGCGAATTGT GACCAGGAAT GCATGATTTA ACAATCCCGA TCAACCCTGT TGTCGGTGGT GGCACTAAAA ATTACCAAAC AGCAACCTAT CAAGCAATGA CAAATACTTT  CCAATCCAAA AAATGATCCA AGCCAAAAGT CTGACAAAAG GGAGGAGGAA GCTTCAGAGC TTTGGAACCT TGCCTAAGCA AGGCAATGGC AGGAAAGAGG AGGAAAGGAT CAAGTTCTTT  TCTTGCTCTT TCTTCCACCC ACGATGTACC AATCGATCAC CCATCAATTC ATCATCAAGA TTGCAAAAGT TAAACATGAT TCGAAAAAGA CTAAAAGAAG CTAGATATAA AGCAGAGAAA  TTAAAGCGAA AGAAATAGAT AGAGGAATCA AGTGACACTG TCACACGCTT CTCCCGGTTC CATTTTGCGT GCGTGCATGT GGAGGCATAT TTTTCACTGT TCCTTTCAAA ATCATTGGCG  AATCCAAGTT AAATTACCCT GCTTTTTATA CTGCATTTTT CTCTCAAAAA ATAGATTTCG AACTAAGTTT GAAGTAATCT CACTCTCTGA AGAAATGTCT GTTAAGTAAG CTCAGGACTA 
TAAATACTAG TGTATATAAG CGGTTCACTT CACAAGTTTT GAGTTGAGTT AAGTTGAGTT GAGTAGTCGA GTGGGCGGCA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1 .........2 .........3 .........4 .........5 .........6 .........7 .........8 .........9 .........0 .........1 .........2
TCAAAAGGGG AGTTGATTTG CAATTCTTCC TGGGATAGCG TGATTTTGTT CTTACGATTT CTTCACTTTT GTCATTTGAA TTTGGTGAAA TTCTAGTAGA AATTTTGCTG CGCGTGTTCT  TGTTGTGTTC AGTGTCGTTG CTGCAACCGG CAAAGCTGTG TTCTTTTGCT TTGAAGTGTG CTGTAGTAAT TTATAGCTGA TGAGAAAAAA AAAACAGAAT ACATACAGTT TACAGTATGA  ACAGAAAATA AGACAAAATT CTCCGAATTA GCGTCAAATG AAGTCTGTAT GCATGCACAG GTAATAACAA AGCTTGCAAA TACATCAAAA GACAGCCATG ATGTATGCTA CTTTATTTGG  AACTTCCTGG CTTACATGCT ACTTTCATCT CAAACACAAC CATGTAGGAA ATTGGTCTCA TCACCAAAAC ATGTTCTTTT TTTCTGACCA AGGATGCTAC CCGACTTACA CTAAAAGCTA  GTAACAAGAG TTCATCATCA CAAGAACAAC AAGCCAAATC TGGCAACAGA AAATTACATC TCATCGATGG CTGAAATAAA GGGATAATAC CTACTGAACC TTAGATCTTG GTGCAGTGCT  GACATAATGT GACACTAATA CACACGCTCA GGTGGACTCA ATGAGAACTT GAGAAGCAGA GCATATTACT CAGATGAGTT ATGTTTGCAT AAGTTTCTGC TGCATGGCAT CGATGAGACT  GAAGAAAGCA AGCCTCCATG CATTACAGAA AAACAGTGCT CCAAACCACA GCCAAACACC AAAGACAGCT CCTGCAGTTA CTGAGCAGTA CAGCCATAGA GTTTCCAGTT CTTGGTGATG  TTCTTTTGCC CCTTCTAGTG TACTCGTAGA ATTTGAATGG TTTGAGCATG GAATTTTCAA AGGAAATCCA CAAAGCCTCA GGTTGTTGGC ATAAATCGAT GGGTCATCCA GTGTTTGGAG 
TTGATTACCT ATAGGTATCT CTCCTGATAG AAGGTTGTTC G 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCACGAGGAGGCGACGCGCGGGCGGCGTGCCAATGGCGGTGATCCGGCTCGGAGTGGCGGCCATCGTCGTCCTCGGCGCCGGCGTGATCGGCGGCGCGCGCGCGCAGCTCAGG
ATGGGGTTCTACGACGAGAGCTGCCCCGCGGCGGAGCGGATCGTCGGGGAGTACGTCCGGCAGCACGTCGGCCGCGTCCCCACCGTCGCCGCCGCGCTCCTCCGGCTGCACTACCACGAC
TGCTTCGTCAGG
GGGTACGTGCGCCGCGCCGCGCCGCGCGGCCGCCATTGATGCGCGTGCAATGTCTGCAATGTGTTTGATGGAATGTGTTGTGCGTTTGTCAAAAAGGGCTGCGACGCG
TCCATCCTCCTCAACTCGACCGGCAATGGCGGCGCGGCGGAGAAGGACGCGGCGCCGAACCAGACGCTGCGAGGGTTCGACCTCATCGACCGCGTCAAGGGCCTCGTGGAGGCGGCCTGC
CCGGGCGTCGTCTCCTGCGCCGACGTCCTCGCGCTCGCCGCCCGCGACGCCGTCGCCGCCATC
TCGTAAGCTCTCGAGCGCTCGCCACGGTCGCCGCGCGCCGCGCGCACTGGCCGGAGC
CTGACGATGCTGAACATGCTCTGCAGGGAGGGCCGTCGTGGCGCGTGCCGACGGGGAGGAGGGATGGCACGGTGTCGAGCATGCAGGAGGCGCTCGCGGAGATCCCCTCGCCGGCGATGA
GCTTCCCGGAGCTCGCCGGCTTGTTCGCCACCAAGGGCCTCAGCGTGCGTGACCTTGTCTGGCTGTCA
CAGGTACGTGACGATTATGAACGAATTCATTAATTCACATTATTAATTACTA
TCCTCGTTTCATCATATTATAAGTCATTTTGATTATTTTCTAAGCCAAACTTATTTAGGTTTGAAAAACATAGCAATATTTTTAACCTATAACAAAGAAATTATCAAAATATGTTAAATG
TTAGATGTAATGAAATTAATTTGGTGTTATGAGTGTTATATTTTTTTTATAAACTAGAAAAAATGCCCGTGCGTTGTAATGGGTGAAGTCTATTTTAATCTTATTATTGTTCACTCTGAA
ATTCACCGTGAGAATTCGCTTGGATATATATTTTTCTAGAAAATCATGCCAAGTTAGCATGTGAGTTTTTTATTGAGATTTCTTATATGACTGTATTTCCAAAAGCGAACGAACTTAAAA
CCTGACTCAAATACGGATCTGTATTTCCAAAAGCAAACGAACTTAAAAATCGACTCATACAAAGATGACGTACCAAAGTACCGGTAAAAACATCTTCAATTTTTATAATAGTAGACAAGA
GATAGAGTTATAGATTAAAATCAAAATATAAAATTAAAACCGACTCAAACACAGATAACAGATCGCGGAAATATCTTTAATTTTTATAATTGTAGAGATTTGATCAAATTTTCAAGAAAT
TTGACAAAAAAAATTCGAAACAACTTATATTATGAAACCGAGGATACTTAGTACCACTTATCTGCACAAACTAAACAACTTGGATTACTCTAGTTAACCAGGTCCAAATTACACTGTTAG
CATGTAATTAATCTCAGTTATCAGCTAAACTAAACAGATTACTCTAGTTAATCAGATCCAAACTACACTATTAGCATGTAATTAATCTGCACTGTCGGTGGGAGACATAATGTAGAAGCT
GTAAGATTAATTTCAGAGAGGAAAGCTTTGTGTCTGAATTTCCAATCCTTTGTTTGCTGACTAGGCATCTGCATGTCTGCATGCAAAAGGAGCACGAATAATAGTTGCTTTCTATCTGTC
AGTTCGTGTTGATGACTAGTCAATTTTATCTACCATTGAACTGACTTAACTTGTTCAGCAATGTCATAATTTCTACAGTTATGATTTATGACCAATGTAAATAAACTGAAATAAATAGAT
TTATATAATCTCGTAAGTTAGCATCAAATCAACCGAAAATTTGGATGCTCGATTCATGTCCAGAAAATGGCGATCTACAGCAAGCCAACATCATAAAAATTCAAGCATGATTTTGTGCAA
GAATGAGGAGTTAAGGACACATGTGTGACATTATCACAATGAATTCTTGGGTGTAAAATGATTTCTGAAAAATTGCATCCGATCGCGCAGGCGCGCACACCATCGGCATCGCCCACTGCT
CGTCCTTCGCCGACCGCCTCTACAACGGCGGCGGCGGCGCCGGCAATGCCAACGGCAACAACACCGACCCGCCGCCGCTGGACGCCGCCTACGCCGCCAACCTGCGTGAGCGCAAGTGCA
GGACGGCCGGCGACGGCGTGGTGGAGATGGACCCCGGCAGCCACCTGACGTTCGATCTCGGCTACTACCGCGCGGTGCTCAGGCACCGCGGCCTGCTCCGGTCCGACGCCGCGCTAGTCA
CCGACGCGGCGGCGCGGGCCGACATCGCCGGCGCCGTGGCGAGCCCGCCGGAGGTGTTCTTCCAGGTGTTCGGCCGGTCGATGGCGACGCTGGGCGCGGTGCAGGTCAAGACCGGCTCCG
ATGGGGAGATCAGGAGGAACTGCGCTGTCGTGAACAGCGGCCACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCACGAGGAGGCGACGCGCGGGCGGCGTGCCAATGGCGGTGATCCGGCTCGGAGTGGCGGCCATCGTCGTCCTCGGCGCCGGCGTGATCGGCGGCGCGCGCGCGCAGCTCAGG
ATGGGGTTCTACGACGAGAGCTGCCCCGCGGCGGAGCGGATCGTCGGGGAGTACGTCCGGCAGCACGTCGGCCGCGTCCCCACCGTCGCCGCCGCGCTCCTCCGGCTGCACTACCACGAC
TGCTTCGTCAGG
GGCTGCGACGCGTCCATCCTCCTCAACTCGACCGGCAATGGCGGCGCGGCGGAGAAGGACGCGGCGCCGAACCAGACGCTGCGAGGGTTCGACCTCATCGACCGCGTC
AAGGGCCTCGTGGAGGCGGCCTGCCCGGGCGTCGTCTCCTGCGCCGACGTCCTCGCGCTCGCCGCCCGCGACGCCGTCGCCGCCATC
GGAGGGCCGTCGTGGCGCGTGCCGACGGGGAGG
AGGGATGGCACGGTGTCGAGCATGCAGGAGGCGCTCGCGGAGATCCCCTCGCCGGCGATGAGCTTCCCGGAGCTCGCCGGCTTGTTCGCCACCAAGGGCCTCAGCGTGCGTGACCTTGTC
TGGCTGTCA
GCGCACACCATCGGCATCGCCCACTGCTCGTCCTTCGCCGACCGCCTCTACAACGGCGGCGGCGGCGCCGGCAATGCCAACGGCAACAACACCGACCCGCCGCCGCTGGAC
GCCGCCTACGCCGCCAACCTGCGTGAGCGCAAGTGCAGGACGGCCGGCGACGGCGTGGTGGAGATGGACCCCGGCAGCCACCTGACGTTCGATCTCGGCTACTACCGCGCGGTGCTCAGG
CACCGCGGCCTGCTCCGGTCCGACGCCGCGCTAGTCACCGACGCGGCGGCGCGGGCCGACATCGCCGGCGCCGTGGCGAGCCCGCCGGAGGTGTTCTTCCAGGTGTTCGGCCGGTCGATG
GCGACGCTGGGCGCGGTGCAGGTCAAGACCGGCTCCGATGGGGAGATCAGGAGGAACTGCGCTGTCGTGAACAGCGGCCACTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGTTTTGAG TTGAGTTAAG TTGAGTTGAG TAGTCGAGTG GGCGGCAATG GCGAGCACGA GGAGGCGACG CGCGGGCGGC GTGCCAATGG CGGTGATCCG GCTCGGAGTG GCGGCCATCG  TCGTCCTCGG CGCCGGCGTG ATCGGCGGCG CGCGCGCGCA GCTCAGGATG GGGTTCTACG ACGAGAGCTG CCCCGCGGCG GAGCGGATCG TCGGGGAGTA CGTCCGGCAG CACGTCGGCC  GCGTCCCCAC CGTCGCCGCC GCGCTCCTCC GGCTGCACTA CCACGACTGC TTCGTCAGGG GCTGCGACGC GTCCATCCTC CTCAACTCGA CCGGCAATGG CGGCGCGGCG GAGAAGGACG  CGGCGCCGAA CCAGACGCTG CGAGGGTTCG ACCTCATCGA CCGCGTCAAG GGCCTCGTGG AGGCGGCCTG CCCGGGCGTC GTCTCCTGCG CCGACGTCCT CGCGCTCGCC GCCCGCGACG  CCGTCGCCGC CATCGGAGGG CCGTCGTGGC GCGTGCCGAC GGGGAGGAGG GATGGCACGG TGTCGAGCAT GCAGGAGGCG CTCGCGGAGA TCCCCTCGCC GGCGATGAGC TTCCCGGAGC  TCGCCGGCTT GTTCGCCACC AAGGGCCTCA GCGTGCGTGA CCTTGTCTGG CTGTCAGGCG CGCACACCAT CGGCATCGCC CACTGCTCGT CCTTCGCCGA CCGCCTCTAC AACGGCGGCG  GCGGCGCCGG CAATGCCAAC GGCAACAACA CCGACCCGCC GCCGCTGGAC GCCGCCTACG CCGCCAACCT GCGTGAGCGC AAGTGCAGGA CGGCCGGCGA CGGCGTGGTG GAGATGGACC  CCGGCAGCCA CCTGACGTTC GATCTCGGCT ACTACCGCGC GGTGCTCAGG CACCGCGGCC TGCTCCGGTC CGACGCCGCG CTAGTCACCG ACGCGGCGGC GCGGGCCGAC ATCGCCGGCG  CCGTGGCGAG CCCGCCGGAG GTGTTCTTCC AGGTGTTCGG CCGGTCGATG GCGACGCTGG GCGCGGTGCA GGTCAAGACC GGCTCCGATG GGGAGATCAG GAGGAACTGC GCTGTCGTGA  ACAGCGGCCA CTGATCAAAA GGGGAGTTGA TTTGCAATTC TTCCTGGGAT AGCGTGATTT TGTTCTTACG ATTTCTTCAC TTTTGTCATT TGAATTTGGT GAAATTCTAG TAGAAATTTT  GCTGCGCGTG TTCTTGTTGT GTTCAGTGTC GTTGCTGCAA CCGGCAAAGC TGTGTTCTTT TGCTTTGAAG TGTGCTGTAG TAATTTATAG CTGATGAGAA AAAAAAAACA GAATACATAC  AGTTTACAGT ATGAACAGAA AATAAGACAA AATTCTCCGA ATTAGCGTCA AATGAAGTCT GTATGCATGC ACAGGTAATA ACAAAGCTTG CAAATACATC AAAAGACAGC CATGATGTAT  GCTACTTTAT TTGGAACTTC CTGGCTTACA TGCTACTTTC ATCTCAAACA CAACCATGTA GGAAATTGGT CTCATCACCA AAACATGTTC TTTTTTTCTG ACCAAGGATG CTACCCGACT  TACACTAAAA GCTAGTAACA AGAGTTCATC ATCACAAGAA CAACAAGCCA AATCTGGCAA CAGAAAATTA CATCTCATCG ATGGCTGAAA TAAAGGGATA ATACCTACTG AACCTTAGAT  CTTGGTGCAG TGCTGACATA ATGTGACACT AATACACACG CTCAGGTGGA CTCAATGAGA ACTTGAGAAG CAGAGCATAT TACTCAGATG AGTTATGTTT GCATAAGTTT CTGCTGCATG  GCATCGATGA GACTGAAGAA AGCAAGCCTC CATGCATTAC AGAAAAACAG TGCTCCAAAC CACAGCCAAA CACCAAAGAC AGCTCCTGCA GTTACTGAGC AGTACAGCCA TAGAGTTTCC  AGTTCTTGGT GATGTTCTTT TGCCCCTTCT AGTGTACTCG TAGAATTTGA ATGGTTTGAG CATGGAATTT TCAAAGGAAA TCCACAAAGC CTCAGGTTGT TGGCATAAAT CGATAAGTTT  TGAGTTGAGT TAAGTTGAGT TGAGTAGTCG AGTGGGCGGC AATGGCGAGC ACGAGGAGGC GACGCGCGGG CGGCGTGCCA ATGGCGGTGA TCCGGCTCGG AGTGGCGGCC ATCGTCGTCC  TCGGCGCCGG CGTGATCGGC GGCGCGCGCG CGCAGCTCAG GATGGGGTTC TACGACGAGA GCTGCCCCGC GGCGGAGCGG ATCGTCGGGG AGTACGTCCG GCAGCACGTC GGCCGCGTCC  CCACCGTCGC CGCCGCGCTC CTCCGGCTGC ACTACCACGA CTGCTTCGTC AGGGGCTGCG ACGCGTCCAT CCTCCTCAAC TCGACCGGCA ATGGCGGCGC GGCGGAGAAG GACGCGGCGC  CGAACCAGAC GCTGCGAGGG TTCGACCTCA TCGACCGCGT CAAGGGCCTC GTGGAGGCGG CCTGCCCGGG CGTCGTCTCC TGCGCCGACG TCCTCGCGCT CGCCGCCCGC GACGCCGTCG  CCGCCATCGG AGGGCCGTCG TGGCGCGTGC CGACGGGGAG GAGGGATGGC ACGGTGTCGA GCATGCAGGA GGCGCTCGCG GAGATCCCCT CGCCGGCGAT GAGCTTCCCG GAGCTCGCCG  GCTTGTTCGC CACCAAGGGC CTCAGCGTGC GTGACCTTGT CTGGCTGTCA GGCGCGCACA CCATCGGCAT CGCCCACTGC TCGTCCTTCG CCGACCGCCT CTACAACGGC GGCGGCGGCG  CCGGCAATGC CAACGGCAAC AACACCGACC CGCCGCCGCT GGACGCCGCC TACGCCGCCA ACCTGCGTGA GCGCAAGTGC AGGACGGCCG GCGACGGCGT GGTGGAGATG GACCCCGGCA  GCCACCTGAC GTTCGATCTC GGCTACTACC GCGCGGTGCT CAGGCACCGC GGCCTGCTCC GGTCCGACGC CGCGCTAGTC ACCGACGCGG CGGCGCGGGC CGACATCGCC GGCGCCGTGG  CGAGCCCGCC GGAGGTGTTC TTCCAGGTGT TCGGCCGGTC GATGGCGACG CTGGGCGCGG TGCAGGTCAA GACCGGCTCC GATGGGGAGA TCAGGAGGAA CTGCGCTGTC GTGAACAGCG  GCCACTGATC AAAAGGGGAG TTGATTTGCA ATTCTTCCTG GGATAGCGTG ATTTTGTTCT TACGATTTCT TCACTTTTGT CATTTGAATT TGGTGAAATT CTAGTAGAAA TTTTGCTGCG  CGTGTTCTTG TTGTGTTCAG TGTCGTTGCT GCAACCGGCA AAGCTGTGTT CTTTTGCTTT GAAGTGTGCT GTAGTAATTT ATAGCTGATG AGAAAAAAAA AACAGAATAC ATACAGTTTA  CAGTATGAAC AGAAAATAAG ACAAAATTCT CCGAATTAGC GTCAAATGAA GTCTGTATGC ATGCACAGGT AATAACAAAG CTTGCAAATA CATCAAAAGA CAGCCATGAT GTATGCTACT  TTATTTGGAA CTTCCTGGCT TACATGCTAC TTTCATCTCA AACACAACCA TGTAGGAAAT TGGTCTCATC ACCAAAACAT GTTCTTTTTT TCTGACCAAG GATGCTACCC GACTTACACT  AAAAGCTAGT AACAAGAGTT CATCATCACA AGAACAACAA GCCAAATCTG GCAACAGAAA ATTACATCTC ATCGATGGCT GAAATAAAGG GATAATACCT ACTGAACCTT AGATCTTGGT  GCAGTGCTGA CATAATGTGA CACTAATACA CACGCTCAGG TGGACTCAAT GAGAACTTGA GAAGCAGAGC ATATTACTCA GATGAGTTAT GTTTGCATAA GTTTCTGCTG CATGGCATCG  ATGAGACTGA AGAAAGCAAG CCTCCATGCA TTACAGAAAA ACAGTGCTCC AAACCACAGC CAAACACCAA AGACAGCTCC TGCAGTTACT GAGCAGTACA GCCATAGAGT TTCCAGTTCT  TGGTGATGTT CTTTTGCCCC TTCTAGTGTA CTCGTAGAAT TTGAATGGTT TGAGCATGGA ATTTTCAAAG GAAATCCACA AAGCCTCAGG TTGTTGGCAT AAATCGATAA GTTTTGAGTT  GAGTTAAGTT GAGTTGAGTA GTCGAGTGGG CGGCAATGGC GAGCACGAGG AGGCGACGCG CGGGCGGCGT GCCAATGGCG GTGATCCGGC TCGGAGTGGC GGCCATCGTC GTCCTCGGCG  CCGGCGTGAT CGGCGGCGCG CGCGCGCAGC TCAGGATGGG GTTCTACGAC GAGAGCTGCC CCGCGGCGGA GCGGATCGTC GGGGAGTACG TCCGGCAGCA CGTCGGCCGC GTCCCCACCG  TCGCCGCCGC GCTCCTCCGG CTGCACTACC ACGACTGCTT CGTCAGGGGC TGCGACGCGT CCATCCTCCT CAACTCGACC GGCAATGGCG GCGCGGCGGA GAAGGACGCG GCGCCGAACC  AGACGCTGCG AGGGTTCGAC CTCATCGACC GCGTCAAGGG CCTCGTGGAG GCGGCCTGCC CGGGCGTCGT CTCCTGCGCC GACGTCCTCG CGCTCGCCGC CCGCGACGCC GTCGCCGCCA  TCGGAGGGCC GTCGTGGCGC GTGCCGACGG GGAGGAGGGA TGGCACGGTG TCGAGCATGC AGGAGGCGCT CGCGGAGATC CCCTCGCCGG CGATGAGCTT CCCGGAGCTC GCCGGCTTGT  TCGCCACCAA GGGCCTCAGC GTGCGTGACC TTGTCTGGCT GTCAGGCGCG CACACCATCG GCATCGCCCA CTGCTCGTCC TTCGCCGACC GCCTCTACAA CGGCGGCGGC GGCGCCGGCA  ATGCCAACGG CAACAACACC GACCCGCCGC CGCTGGACGC CGCCTACGCC GCCAACCTGC GTGAGCGCAA GTGCAGGACG GCCGGCGACG GCGTGGTGGA GATGGACCCC GGCAGCCACC  TGACGTTCGA TCTCGGCTAC TACCGCGCGG TGCTCAGGCA CCGCGGCCTG CTCCGGTCCG ACGCCGCGCT AGTCACCGAC GCGGCGGCGC GGGCCGACAT CGCCGGCGCC GTGGCGAGCC  CGCCGGAGGT GTTCTTCCAG GTGTTCGGCC GGTCGATGGC GACGCTGGGC GCGGTGCAGG TCAAGACCGG CTCCGATGGG GAGATCAGGA GGAACTGCGC TGTCGTGAAC AGCGGCCACT  GATCAAAAGG GGAGTTGATT TGCAATTCTT CCTGGGATAG CGTGATTTTG TTCTTACGAT TTCTTCACTT TTGTCATTTG AATTTGGTGA AATTCTAGTA GAAATTTTGC TGCGCGTGTT  CTTGTTGTGT TCAGTGTCGT TGCTGCAACC GGCAAAGCTG TGTTCTTTTG CTTTGAAGTG TGCTGTAGTA ATTTATAGCT GATGAGAAAA AAAAAACAGA ATACATACAG TTTACAGTAT  GAACAGAAAA TAAGACAAAA TTCTCCGAAT TAGCGTCAAA TGAAGTCTGT ATGCATGCAC AGGTAATAAC AAAGCTTGCA AATACATCAA AAGACAGCCA TGATGTATGC TACTTTATTT  GGAACTTCCT GGCTTACATG CTACTTTCAT CTCAAACACA ACCATGTAGG AAATTGGTCT CATCACCAAA ACATGTTCTT TTTTTCTGAC CAAGGATGCT ACCCGACTTA CACTAAAAGC  TAGTAACAAG AGTTCATCAT CACAAGAACA ACAAGCCAAA TCTGGCAACA GAAAATTACA TCTCATCGAT GGCTGAAATA AAGGGATAAT ACCTACTGAA CCTTAGATCT TGGTGCAGTG  CTGACATAAT GTGACACTAA TACACACGCT CAGGTGGACT CAATGAGAAC TTGAGAAGCA GAGCATATTA CTCAGATGAG TTATGTTTGC ATAAGTTTCT GCTGCATGGC ATCGATGAGA  CTGAAGAAAG CAAGCCTCCA TGCATTACAG AAAAACAGTG CTCCAAACCA CAGCCAAACA CCAAAGACAG CTCCTGCAGT TACTGAGCAG TACAGCCATA GAGTTTCCAG TTCTTGGTGA  TGTTCTTTTG CCCCTTCTAG TGTACTCGTA GAATTTGAAT GGTTTGAGCA TGGAATTTTC AAAGGAAATC CACAAAGCCT CAGGTTGTTG GCATAAATCG ATAAGTTTTG AGTTGAGTTA  AGTTGAGTTG AGTAGTCGAG TGGGCGGCAA TGGCGAGCAC GAGGAGGCGA CGCGCGGGCG GCGTGCCAAT GGCGGTGATC CGGCTCGGAG TGGCGGCCAT CGTCGTCCTC GGCGCCGGCG  TGATCGGCGG CGCGCGCGCG CAGCTCAGGA TGGGGTTCTA CGACGAGAGC TGCCCCGCGG CGGAGCGGAT CGTCGGGGAG TACGTCCGGC AGCACGTCGG CCGCGTCCCC ACCGTCGCCG  CCGCGCTCCT CCGGCTGCAC TACCACGACT GCTTCGTCAG GGGCTGCGAC GCGTCCATCC TCCTCAACTC GACCGGCAAT GGCGGCGCGG CGGAGAAGGA CGCGGCGCCG AACCAGACGC  TGCGAGGGTT CGACCTCATC GACCGCGTCA AGGGCCTCGT GGAGGCGGCC TGCCCGGGCG TCGTCTCCTG CGCCGACGTC CTCGCGCTCG CCGCCCGCGA CGCCGTCGCC GCCATCGGAG  GGCCGTCGTG GCGCGTGCCG ACGGGGAGGA GGGATGGCAC GGTGTCGAGC ATGCAGGAGG CGCTCGCGGA GATCCCCTCG CCGGCGATGA GCTTCCCGGA GCTCGCCGGC TTGTTCGCCA  CCAAGGGCCT CAGCGTGCGT GACCTTGTCT GGCTGTCAGG CGCGCACACC ATCGGCATCG CCCACTGCTC GTCCTTCGCC GACCGCCTCT ACAACGGCGG CGGCGGCGCC GGCAATGCCA  ACGGCAACAA CACCGACCCG CCGCCGCTGG ACGCCGCCTA CGCCGCCAAC CTGCGTGAGC GCAAGTGCAG GACGGCCGGC GACGGCGTGG TGGAGATGGA CCCCGGCAGC CACCTGACGT  TCGATCTCGG CTACTACCGC GCGGTGCTCA GGCACCGCGG CCTGCTCCGG TCCGACGCCG CGCTAGTCAC CGACGCGGCG GCGCGGGCCG ACATCGCCGG CGCCGTGGCG AGCCCGCCGG  AGGTGTTCTT CCAGGTGTTC GGCCGGTCGA TGGCGACGCT GGGCGCGGTG CAGGTCAAGA CCGGCTCCGA TGGGGAGATC AGGAGGAACT GCGCTGTCGT GAACAGCGGC CACTGATCAA  AAGGGGAGTT GATTTGCAAT TCTTCCTGGG ATAGCGTGAT TTTGTTCTTA CGATTTCTTC ACTTTTGTCA TTTGAATTTG GTGAAATTCT AGTAGAAATT TTGCTGCGCG TGTTCTTGTT  GTGTTCAGTG TCGTTGCTGC AACCGGCAAA GCTGTGTTCT TTTGCTTTGA AGTGTGCTGT AGTAATTTAT AGCTGATGAG AAAAAAAAAA CAGAATACAT ACAGTTTACA GTATGAACAG  AAAATAAGAC AAAATTCTCC GAATTAGCGT CAAATGAAGT CTGTATGCAT GCACAGGTAA TAACAAAGCT TGCAAATACA TCAAAAGACA GCCATGATGT ATGCTACTTT ATTTGGAACT  TCCTGGCTTA CATGCTACTT TCATCTCAAA CACAACCATG TAGGAAATTG GTCTCATCAC CAAAACATGT TCTTTTTTTC TGACCAAGGA TGCTACCCGA CTTACACTAA AAGCTAGTAA  CAAGAGTTCA TCATCACAAG AACAACAAGC CAAATCTGGC AACAGAAAAT TACATCTCAT CGATGGCTGA AATAAAGGGA TAATACCTAC TGAACCTTAG ATCTTGGTGC AGTGCTGACA  TAATGTGACA CTAATACACA CGCTCAGGTG GACTCAATGA GAACTTGAGA AGCAGAGCAT ATTACTCAGA TGAGTTATGT TTGCATAAGT TTCTGCTGCA TGGCATCGAT GAGACTGAAG  AAAGCAAGCC TCCATGCATT ACAGAAAAAC AGTGCTCCAA ACCACAGCCA AACACCAAAG ACAGCTCCTG CAGTTACTGA GCAGTACAGC CATAGAGTTT CCAGTTCTTG GTGATGTTCT 
TTTGCCCCTT CTAGTGTACT CGTAGAATTT GAATGGTTTG AGCATGGAAT TTTCAAAGGA AATCCACAAA GCCTCAGGTT GTTGGCATAA ATCGAT 

Retrieve as FASTA