Entry information : EcamPrx100 ( EcC079626.10)
Entry ID 10345
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EcamPrx100 ( EcC079626.10)
Name (synonym) EcamPrx100 ( EcC079626.10)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx100
start..stop
S start..stop
EgrPrx100 628 0 1..317 1..324
EguPrx100 619 0 1..317 1..324
EglPrx100 616 0 1..317 1..324
CclPrx116 452 9.28e-162 11..305 8..309
Gene structure Fichier Exons


exon

Literature and cross-references EcamPrx100 ( EcC079626.10)
Protein sequence: EcamPrx100 ( EcC079626.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   34214.84 (31776.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.55 (4.58) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDLELSRVLALLAYCCLMGTGNAQLRFGFYGQTCPSAEPIVRSVVRNAVISNPNMAAILLRLHFHDCFVEGCDGSILIENGRSAERNAFGHQGVGGFEVIEEAKKHLEVACPGVVSCADI
VALAARDAVAMANGPDYEVLTGRRDGRVSNVSLAEDMPDVGDSIQQLKSKFFQKGLTEKDLVLLSxACFFMTDRLYNFMPGGGSDPSINPDFLPELKSMCPQNGDVNVRMPIDHGSEQTF
DDQILRNIRSGWAVLESDAKLNDDPVTRSVIESYVGLFNPIFGPSFEADFVESMVKMGQIGVKMGSxWRDQAGLQIF

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa. joined with EcC079626.10 (3' end is missing due to short contig) and EcC065068.10 (5' end is missing due to the ending of contig). Close to EcC014857.20, EcS561710.10, EcS565674.10 and EcC014857.60 (Removed). GEIR is missing but found in another frame.
DNA
Send to BLAST
CDS
Send to BLAST