Entry information : OsPrx26(LOC_Os02g14170)
Entry ID 1036
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2010-08-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx26(LOC_Os02g14170)
Name OsPrx26(LOC_Os02g14170)
Class Class III peroxidase    [Orthogroup: Prx148]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx26
start..stop
S start..stop
SiPrx78 486 4.07e-175 30..326 24..320
BdiPrx97 482 3.15e-173 9..326 4..324
ZmPrx67 474 3e-170 31..326 25..320
TaPrx130-1A 471 7.42e-169 9..326 13..329
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx26(LOC_Os02g14170)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004).
Protein ref. UniProtKB:   Q5U1R7
DNA ref. GenBank:   NC_008395.1 (7760171..7761341)
Protein sequence: OsPrx26(LOC_Os02g14170)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   33423.94 (30785.3) Transmb domain:   %s   i11-28o
PI (pH):   %s   6.97 (6.00) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVGGRGRRPLLLLLLLLAVALALAARARAQLSPGFYSASCPTVHGVVRQVMSQAVMNDTRAGAAVLRLFYHDCFVGGCDASVLLDDTPAAPGEKGVGPNAVGSTTVFDLVDTIKAQVEA
VCPATVSCADVLAIAARDSVNLLGGPSWAVPLGRRDALSPSRSAVSTDLPGPEADISALVSAFAAKGLSSRDLAALSGAHTVGRASCVNFRTRVYCDANVSPAFASHQRQSCPASGGDAA
LAPLDSLTPDAFDNGYYRNLVAGAGLLHSDQELFNNGPVDSVVQLYSSNAAAFSSDFAASMIRLGNIGPLTGSTGEVRLNCRKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2). 5 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST