Entry information : EcamPrx65 (EcS764278.10)
Entry ID 10379
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx65 (EcS764278.10)
Name (synonym) EcamPrx65 (EcS764278.10)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx65
start..stop
S start..stop
EguPrx65 377 1.74e-135 1..186 65..250
EgrPrx65 377 3.83e-134 1..186 138..323
EguPrx66 356 4.74e-126 1..186 138..323
EgrPrx66 356 5.11e-126 1..186 138..323
Gene structure Fichier Exons


exon

Literature and cross-references EcamPrx65 (EcS764278.10)
Protein sequence: EcamPrx65 (EcS764278.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186
PWM (Da):   %s   19789.96  
PI (pH):   %s   10.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LGGPSWEVKLGRRDARTASFSLANSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCISFRSRIYNDSNIDSSFSKTRQGKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKN
LLSNKGLLHSDQELFNGGSTDSLVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (5' end is missing due to short contig).
DNA
Send to BLAST
CDS
Send to BLAST