1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx36 (EcS776350.10)
Entry ID 10380
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx36 (EcS776350.10)
Name (synonym) EcamPrx36 (EcS776350.10)
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx36
start..stop		 S start..stop
EglPrx33 275 3.95e-95 1..142 1..142
EgrPrx33 275 1.03e-94 1..142 1..142
EgrPrx39 275 1.07e-94 1..142 1..142
EgrPrx36 274 3.46e-94 1..142 1..142
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx36 (EcS776350.10)
Protein sequence: EcamPrx36 (EcS776350.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   149 (126)
PWM (Da):   %s   16177.43 (13799.1)  
PI (pH):   %s   6.74 (6.74) Peptide Signal:   %s   cut: 24 range:24-149
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALNSLSLVQALLFLSLATSAFSTRRYKEGLTPYFYHYVCPQALP
AIKRVVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPIPTIDSEKLAVPNNNLARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVAVCLILMLH

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (3' end is missing due to the ending of contig).
DNA ►
Send to BLAST
CDS►
Send to BLAST