Entry information : OsPrx32(LOC_Os02g58720)
Entry ID 1042
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx32(LOC_Os02g58720)
Name OsPrx32(LOC_Os02g58720)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx32
start..stop
S start..stop
ZmPrx136 484 3.97e-174 32..326 29..328
TaPrx183-1D 474 3.77e-169 18..326 70..381
SiPrx75 467 2.9e-167 36..326 29..322
SbPrx82 459 5.95e-164 32..326 31..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1042' 'join(35894158..35894397,35894475..35894663,35894768..35895319)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35894158..35894397 238 N° 2 35894475..35894663 187 N° 3 35894768..35895319 550  
join(35894158..35894397,35894475..35894663,35894768..35895319)


exon

Literature and cross-references OsPrx32(LOC_Os02g58720)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1R1
DNA ref. GenBank:   NC_008395.1 (35894170..35895316)
Protein sequence: OsPrx32(LOC_Os02g58720)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   34287.11 Transmb domain:   %s   o15-37i
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAMASSQSHLDLVQLLIVVVMTMTMLVGGGEALSLDYYAKSCPKAEAAVAAAVKQAMAKDRTVPAGLLRLHFHDCFVRGCDGSVLLDSSGNMSAEKDGPPNASLHAFYVIDNAKAAVE
ALCPGVVSCADILALAARDAVAM
SGGPSWQVPVGRRDGRVSLASETTTALPGPTASFDQLKQAFHGRGMSTKDLVVLSGGHTLGFAHCSSFQNRIQPQGVDPALHPSFAATLRRSCPPNN
TARSAGSSLDPTSSAFDNFYYRMLLSGRGLLSSDEALLTHPKTRAQVTLYAASQPAFFRDFVDSMLRMSSLNNVAGEVRANCRRVN*

Retrieve as FASTA  
Remarks chromosome 2. 4 ESTs. Rice cDNA EST clone
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAGCAATGGCGTCGTCCCAGTCCCATCTGGATCTGGTACAGCTGCTAATCGTTGTGGTGATGACTATGACGATGCTGGTGGGTGGCGGCGAGGCGCTGAGCCTGGACTACTAC
GCCAAGAGCTGCCCCAAGGCGGAGGCGGCGGTGGCGGCGGCGGTGAAGCAGGCCATGGCCAAAGACCGCACGGTGCCGGCCGGCCTGCTCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GGGTAACTAGCTAGCTACTCTATCGAATTCGAATATATATATATTAACATCAATGAAGGAAGCTGCTAGCTAGCTGCAGGGGTGCGACGGTTCCGTGCTTTTGGACTCGTCGGGGAACAT
GTCGGCGGAGAAGGACGGCCCACCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGGCCGCCGTCGAAGCCCTCTGCCCCGGCGTCGTCTCCTGCGCTGACATCCTCGC
GCTGGCCGCCAGGGACGCAGTCGCCATG
TGGTAATCCGGCCGGCCCTCAATCAAATTAAGTAGTAAATACAGGAGTATATCAATATATAGCTAGATGAGATGGAGTACTAAACGTACGTA
CGTACTGCATGCAGTCCGGTGGTCCTTCTTGGCAAGTGCCGGTGGGTCGTCGTGACGGGCGCGTGTCGCTGGCGAGCGAGACGACGACGGCGCTACCGGGGCCGACGGCGAGCTTCGACC
AGCTGAAGCAGGCGTTCCACGGGCGCGGGATGTCGACCAAGGACCTGGTGGTGCTGTCGGGGGGTCACACGCTTGGCTTCGCACACTGCTCCTCCTTCCAGAACCGCATCCAGCCGCAGG
GCGTCGACCCCGCGCTTCACCCCTCCTTCGCCGCCACCCTCCGCCGCTCCTGCCCACCCAACAACACCGCCAGGTCTGCCGGCTCCTCCCTCGACCCCACCTCCTCCGCCTTCGACAACT
TCTACTATCGGATGCTGCTCTCCGGCCGTGGCCTTCTCTCCTCCGACGAGGCGCTGCTCACCCACCCCAAGACGCGCGCCCAGGTCACGCTCTACGCCGCGTCGCAGCCCGCCTTCTTCC
GTGACTTCGTCGACTCCATGCTACGGATGAGCTCCCTCAACAACGTCGCCGGCGAGGTCCGAGCCAACTGCAGGCGCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCAGCAATGGCGTCGTCCCAGTCCCATCTGGATCTGGTACAGCTGCTAATCGTTGTGGTGATGACTATGACGATGCTGGTGGGTGGCGGCGAGGCGCTGAGCCTGGACTACTAC
GCCAAGAGCTGCCCCAAGGCGGAGGCGGCGGTGGCGGCGGCGGTGAAGCAGGCCATGGCCAAAGACCGCACGGTGCCGGCCGGCCTGCTCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GGGTGCGACGGTTCCGTGCTTTTGGACTCGTCGGGGAACATGTCGGCGGAGAAGGACGGCCCACCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGGCCGCCGTCGAA
GCCCTCTGCCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCGCTGGCCGCCAGGGACGCAGTCGCCATG
TCCGGTGGTCCTTCTTGGCAAGTGCCGGTGGGTCGTCGTGACGGGCGCGTG
TCGCTGGCGAGCGAGACGACGACGGCGCTACCGGGGCCGACGGCGAGCTTCGACCAGCTGAAGCAGGCGTTCCACGGGCGCGGGATGTCGACCAAGGACCTGGTGGTGCTGTCGGGGGGT
CACACGCTTGGCTTCGCACACTGCTCCTCCTTCCAGAACCGCATCCAGCCGCAGGGCGTCGACCCCGCGCTTCACCCCTCCTTCGCCGCCACCCTCCGCCGCTCCTGCCCACCCAACAAC
ACCGCCAGGTCTGCCGGCTCCTCCCTCGACCCCACCTCCTCCGCCTTCGACAACTTCTACTATCGGATGCTGCTCTCCGGCCGTGGCCTTCTCTCCTCCGACGAGGCGCTGCTCACCCAC
CCCAAGACGCGCGCCCAGGTCACGCTCTACGCCGCGTCGCAGCCCGCCTTCTTCCGTGACTTCGTCGACTCCATGCTACGGATGAGCTCCCTCAACAACGTCGCCGGCGAGGTCCGAGCC
AACTGCAGGCGCGTCAACTAG

Retrieve as FASTA