1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx22 ( EcC030597.20)
Entry ID 10423
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-17 (Achraf Jemmat)
Peroxidase information: EcamPrx22 ( EcC030597.20)
Name (synonym) EcamPrx22 ( EcC030597.20)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx22
start..stop		 S start..stop
EcamPrx21 641 0 1..319 1..319
EgrPrx21 640 0 1..319 1..319
EglPrx21 640 0 1..319 1..319
EguPrx21 637 0 1..319 1..319
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx22 ( EcC030597.20)
Protein sequence: EcamPrx22 ( EcC030597.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   33247.38 (30551.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARESSSVRSAFLLLLCFLLETASAQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTANFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIV
SCADLLTVAARDSVVALGGPSWTVPLGRRDSTTASQSAANSNIPAPTLSLSGLITAFSNKGFTAKEMLALSGSHTIGQARCTTFRTRLYNENNINATFATSLKANCPSSGGDNNLSPLDT
TSPTSFDNAYFKNLQIQKGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKSCGKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from Kazuza (splicing error of eintron 1).
DNA ►
Send to BLAST
CDS►
Send to BLAST