Entry information : OsPrx33(LOC_Os03g02920)
Entry ID 1043
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx33(LOC_Os03g02920)
Name OsPrx33(LOC_Os03g02920)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Pannicles
Roots
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx33
start..stop
S start..stop
SiPrx154 543 0 1..331 1..331
PedPrx04 523 0 9..331 1..326
SbPrx23_BTx623 504 0 27..331 30..333
SofPrx03 501 0 24..331 24..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1155473..1155700 228 N° 2 1154684..1154872 189 N° 3 1152280..1152858 579  
complement(join(1152280..1152858,1154684..1154872,1155473..1155700))


exon

Literature and cross-references OsPrx33(LOC_Os03g02920)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8LMR7
DNA ref. GenBank:   NC_008396.1 (1155640..1152283)
Protein sequence: OsPrx33(LOC_Os03g02920)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   34429.75  
PI (pH):   %s   5.29
Sequence 373
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARGSRGMRLWLLSVAVMAMAMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEKDAPPNTSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTNCRVAS*

Retrieve as FASTA  
Remarks chromosome 3. 12 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCGCGAGGAAGCAGAGGAATGCGGCTGTGGCTCCTGTCCGTGGCGGTGATGGCCATGGCGATGGCGACGAGGTCGCAGGCGCAGCTGCAGGTCGGGTACTACGACACGCTGTGC
CCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGTGTCCGGGAACCCCGGCATGGCCGCCGGCCTCGTCCGTCTCCACTTCCACGACTGCTTCGTCAGG
GTCAGTACAGTA
ACTAATAGTAACTTATTACACCACCAAATTCGGTTCCTCCATTAATGAGACCACGTATACTAGCTTGTTGGGGATGTGAAGCTAATTAAGCTAGAGATAGATGCCTTTGCAAAGTTGCAA
CTGCATATATGCGGCGGCTGCACATACAAGTGTTTTTTTGAGTGATCCAATGGTTGCAACGTGATGTCACTGTGGGGATGTGCTTCGCTTGCATATGGAGCCTCTGCATCTCTTTTGCCG
CGCACCCTGCTCTGCTTCGTCCGTTTCTCGCGTATGTAGTACTGTACTTAATTTTACTGCGAGGATGATAAGCCGATCGAGGTAGGGGAATAATGCACGCACGGTAGATTGCTGCACCGT
GTCTGCACCTGCACGGAACGATGGGATACTCTGGAACCATGACAGCTAGAAATCGCTCGTTCATGTTTGCCATCTGGCATCCCCTGTTTTATCCTAGCATCCAAAACATTAGTACAGTGC
TACAGTCAATCAATCAAGCACGTAGTACCTGTGTTACCTAATTTACTGCATTCGTTTTGACATGTGGTGCACGTAATAGCGAGACACCTGAATTCCTTGTGGATGCAGGGGTGCGACGCG
TCGGTGCTGCTGGACTCGACGCAGGGGAACAGGGCGGAGAAGGACGCGCCCCCGAACACGAGCCTCCGCGGCTTCGAGGTCATCGACAGCGCCAAGTCCCGCCTCGAGACGGCCTGCTTC
GGCGTCGTCTCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGGGACGCCCTCGCGCTG
GTACGTACGTTTTCTTCTGCTCCATTGAATTACCAGCTGCTTCCTCCGGCGCATCACTGCTAG
TGCTTGCTACTTGCCCGTGCGGGTACAAGTCGGGGGGGATCACAACGCGCACGGCGCACGGTTGATTCGTCGGTGGATTGGGTGATTTGCGAGTGATAGATAGATAGATCGAGCCTGGAA
TATAAAACCGGTCGGGCCCTACACGGATTGCCCCAACTTTCGTTCTATCTTTCTCCAAAAGCTGACGCTGAAAGTAGTTGTACTCCGACTGGCAGTAGGAACTTACTCTGTTCTTCTCCT
TTCCGATCGATGCTGCCGGCCCGACCCGGCGTAGAATGGGAGGTGATTCATTGCCGATGCTTTTCTGGAAGCAACGCACCACGGCGGCATCACGCACGATATGTGCCGATGCCGCGATGC
GACTGCAGGAGAAGCAGAGGCCGCTCTTTTTCTTTTGTTTTGGTTGGTTCACGTATAATGAGCCCGTTGTCTGCACGGACCCACCGGTCGGTGTCCGTATCAGCGTCACATGGCCGTGTC
GCCCTCACACAGGTTAAGGAAAAGAGAGCCTTTGCTTTCCAAAATCGATCATCTTTTGGGGATGCGCCAAAAGAATGGAGATTAAGTAATCCAATCTGATCGTGGGATCATGGCACTTGG
CACACTAATAAAGTTCACTTTAACCCTCTGGGGGTGATGAACAGTTATTTTAGGAGGCTGGTGTGATGGGCCAACTCCAATCATTCCTAATCTAGCTTTGCTCCGATCTCCATGCAAACA
AATCGTAAACTGTATCGCCATGCAATTCAGTGTAGAAGGAAGTTGAGACATCGATCGGAGCAAAATTATGGAGTACTAGTACTAGTACGTTCGTATGATTATATTGATTCAGTTGGACTA
AATTTGATTATTACTGACGCCACAACGGTAAAGTAGGAGCATTACGACATGATATATACGGTCAGCAGGTTTAGAACCATTTTTTGTGTTACATGTGTTTTTTAAATGAACATTACTGAT
CATACGACCGTTGCAGTTTCATATTGTTCAAGTTGACATATTCTGAACAAGTAGTCAAAGATTCCTCACTAGTGGTAAGTCAATGGAGTATACAGTATATACCACCACGTCAATAATTCA
CAACCGACCAAATGCATGTATTTTCCAAATAGACACTAGCATATTTATCAATTTATGAACTCCAAATGGTGCTCTGTTAAGACCGTTATACTGAAACTTCAGCTGGAGCTGGAAACAACA
CATAGATGATGCGTATGCGTGTGCATAACCTTTCACATCATCACATGATGAAAAAGACATATACCTGCAAAAAGCAACGCTAGTGAGTAGTGACGACTCCAGCCCTCTCCGGTATCAATC
AGGATTACATTAGGGGATAACCAAAGAGGAAATTAAATACCGAAAGCTACGAGGAGGGGTTTAATTCTGGGGGCAGGATGAGCAAGTGGGACGGATAGTTTACGTGGATTCGTCTCACGC
CCATGTGGCCGGCACGCCCATCGGTCCACAACACCACATGCCATGGATCGATCGGTTTAGTTTGTCCCCATTCCCTCCCGTTGTGCGGCCCATGCGTCCCCCCGCCGCTTCACCACCAAC
CCAATCAACCATGTGCCGCGTCTAACTAACTCGAGAACACAAACCACTGTACGGTTTCCATCCCTAATCTACATGTTTCCGTGTATCACATGGATATAGGTACACCGCTGATGCACGAGC
CAAGATGACAGCAGCTAAAATTATACTTTTAGTACAGTTTTTGAGAAACAGAGTAACAATTGGCGTGCGTGTGTACGTGCAGGTGGGAGGGAACGCGTACCAGGTGCCGGGGGGGAGGAG
AGACGGCAACGTGTCGGTGGCGCAGGAGACGAACGGGAACCTGCCGCCGCCGTCGGCGAACGTGGCGCAGCTGAACCAGATGTTCGGCGCCAAGGGGCTCACCCAGGCGGAAATGGTGGC
ACTGTCGGGCGCGCACACCATCGGCGTGTCGCACTGCAGCTCCTTCAGCAACCGCCTCTACTCGTCGGGCCCCAACGCCGGGCAGGACCCCAGCATGGACCCCAGCTACGTCGCCGCGCT
GACGACGCAGTGCCCGCAGCAGCAGGGGCAGCCCGCGGCGGGGATGGTGCCCATGGACGCCGTCACGCCCAACGCCTTTGACACCAACTACTACGCCGCCATTGTCGCTAACCGGGGATT
GCTCAGCTCCGACCAGGCGCTCCTCGCCGACCAGACCACCGCCGCGCAGGTCGTCGGCTACACCAACAACCCGGACTCGTTCCAGACCGACTTCGCCGCCGCCATGGTCAAGATGGGCTC
CATCGGCGTGCTCACCGGCAACGCCGGCACCATCAGGACAAACTGCAGGGTGGCCAGCTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCGCGAGGAAGCAGAGGAATGCGGCTGTGGCTCCTGTCCGTGGCGGTGATGGCCATGGCGATGGCGACGAGGTCGCAGGCGCAGCTGCAGGTCGGGTACTACGACACGCTGTGC
CCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGTGTCCGGGAACCCCGGCATGGCCGCCGGCCTCGTCCGTCTCCACTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCG
TCGGTGCTGCTGGACTCGACGCAGGGGAACAGGGCGGAGAAGGACGCGCCCCCGAACACGAGCCTCCGCGGCTTCGAGGTCATCGACAGCGCCAAGTCCCGCCTCGAGACGGCCTGCTTC
GGCGTCGTCTCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGGGACGCCCTCGCGCTG
GTGGGAGGGAACGCGTACCAGGTGCCGGGGGGGAGGAGAGACGGCAACGTGTCGGTGGCGCAG
GAGACGAACGGGAACCTGCCGCCGCCGTCGGCGAACGTGGCGCAGCTGAACCAGATGTTCGGCGCCAAGGGGCTCACCCAGGCGGAAATGGTGGCACTGTCGGGCGCGCACACCATCGGC
GTGTCGCACTGCAGCTCCTTCAGCAACCGCCTCTACTCGTCGGGCCCCAACGCCGGGCAGGACCCCAGCATGGACCCCAGCTACGTCGCCGCGCTGACGACGCAGTGCCCGCAGCAGCAG
GGGCAGCCCGCGGCGGGGATGGTGCCCATGGACGCCGTCACGCCCAACGCCTTTGACACCAACTACTACGCCGCCATTGTCGCTAACCGGGGATTGCTCAGCTCCGACCAGGCGCTCCTC
GCCGACCAGACCACCGCCGCGCAGGTCGTCGGCTACACCAACAACCCGGACTCGTTCCAGACCGACTTCGCCGCCGCCATGGTCAAGATGGGCTCCATCGGCGTGCTCACCGGCAACGCC
GGCACCATCAGGACAAACTGCAGGGTGGCCAGCTG

Retrieve as FASTA