1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx[P]06 (EcC012499.40)
Entry ID 10445
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-16 (Qiang Li)
Peroxidase information: EcamPrx[P]06 (EcC012499.40)
Name (synonym) EcamPrx[P]06 (EcC012499.40)
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]06
start..stop		 S start..stop
EgrPrx[P]11 433 2.26e-154 1..288 1..327
EgrPrx[P]06 421 1.92e-149 1..288 1..332
EglPrx[P]06 365 9.2e-128 1..288 1..307
EguPrx12 345 1.19e-119 1..288 1..334
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx[P]06 (EcC012499.40)
Protein sequence: EcamPrx[P]06 (EcC012499.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287 (268)
PWM (Da):   %s   32207.13 (30140.0)  
PI (pH):   %s   7.69 (7.38) Peptide Signal:   %s   cut: 20 range:20-287
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPSRLWQLLLSALALVSSCQVQHNANAAETMDPPQKLQWLYYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIQLLYSDCFVTVCIACFLMEMIDKVKEVLEQHCPRDVSCTxIINLAAK
DAVVLVGGTSYPIPMGRRDENSSSAKSVDLPGGAFTGQDQLQLHPGQVVRFQQNWRARPKHGPNLLAQLREQCPPNSTNLAYLNPDLGSSYSFGKSFYSRVRHHQAVLGINQQIASNFDS
SLIAWEYDLRFGDLQKMFGTSTIRMGNIKLPPEDQG*IRKNCQVVDRK

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (stops in frame; PS is missing). Close to (EcC012499.30, Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing; stop in frame))
DNA ►
Send to BLAST
CDS►
Send to BLAST