Entry information : EcamPrx[P]128 ( EcC012563.20)
Entry ID 10448
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-21 (Christophe Dunand)
Peroxidase information: EcamPrx[P]128 ( EcC012563.20)
Name (synonym) EcamPrx[P]128 ( EcC012563.20)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]128
start..stop
S start..stop
EguPrx[P]128 497 3.17e-180 20..298 1..266
EgrPrx[P]128 495 1.16e-179 20..298 1..266
EglPrx[P]128 491 3.69e-178 20..298 1..266
EgrPrx[P]127 388 4.06e-137 9..298 18..277
Gene structure Fichier Exons


exon

Literature and cross-references EcamPrx[P]128 ( EcC012563.20)
Protein sequence: EcamPrx[P]128 ( EcC012563.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295
PWM (Da):   %s   31799.03  
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LALAFLALHHGVCHGSELKMTFYRESCPRAEAIVRNITWSRVAANPALPAKILRLQFRDCFVRGYNALVLLDSTNGTSAEKDTIPNRSLEGFDVIDEIKAELEAECPLTVSCADVLALAA
*DGVSFQFGRAM*GVLTGRRDGRVSLASEALDNLPSPASDFNTLQQQFADNGQGVPDLVALSGVHTIGVAHCVVFAKRLFSFTGNNDTTDASLDPGYTTTLKAQCLSPRNTVGLDPNSSx
SFDSHYFVALFRNQGLFTSDVTLLTDKRAANFAWIYRKFNVFLA*FGYSMKKMGATAV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Kazusa (Stops in frame; Both 5' and 3' ends are missing).
DNA
Send to BLAST
CDS
Send to BLAST