1. Browse the Database
  2. View Redoxidase
Entry information : EcamPrx[P]172 ( EcC020752.90)
Entry ID 10453
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EcamPrx[P]172 ( EcC020752.90)
Name (synonym) EcamPrx[P]172 ( EcC020752.90)
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]172
start..stop		 S start..stop
EgrPrx[P]172 406 4.62e-144 32..318 1..279
EgrPrx167 396 2.12e-139 1..318 1..315
EguPrx167 389 1.37e-136 1..318 1..315
EgrPrx169 384 7.72e-135 1..318 1..315
Gene structure Fichier Exons►


exon

Literature and cross-references EcamPrx[P]172 ( EcC020752.90)
Protein sequence: EcamPrx[P]172 ( EcC020752.90)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (292)
PWM (Da):   %s   34279.23 (31677.9)  
PI (pH):   %s   8.14 (7.71) Peptide Signal:   %s   cut: 24 range:24-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPNTPHKLCFLLFIYRIPSTSALT*LSKENYYAGKYPKELETVR
SNMKVAVAKEARLGASLLCLHFHDYFVNGCDASILLDDTANFIGEKTARPNANSVRRFDLIDTIKLEAEKLCPGVVSCADILVITARDSVVAVSANPWTELASLARKKGFDHGERNHC*YQPSTPKLNLSDLITAFTNKGFIAQEIVA
LLGSHAIGKARCTTFRDQLYNESNMNSSFATPSKANCPSSGGNNNISPLDVTSPTSFDNNYFQNLVSQKGLYYSDQQLFNGGSTNAQVTAYSKNFGSF*EDFAKVVVKMGGLTPLTGCPS
LIFK

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Kazusa (Stops in frame; 5' end is missing which has been completed).
DNA ►
Send to BLAST
CDS►
Send to BLAST