Entry information : OsPrx36(LOC_Os03g05770)
Entry ID 1046
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx36(LOC_Os03g05770)
Name OsPrx36(LOC_Os03g05770)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx36
start..stop
S start..stop
ZmPrx132 464 1.27e-161 26..435 23..439
SiPrx169 459 3.28e-161 26..365 23..356
ZmPrx53 460 3.4e-160 1..358 1..347
BdiPrx43 455 3.43e-158 1..348 55..402
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1046' 'join(2860640..2860855,2860959..2862203)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2860640..2860855 214 N° 2 2860959..2862203 1243  
join(2860640..2860855,2860959..2862203)


exon

Literature and cross-references OsPrx36(LOC_Os03g05770)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q7
DNA ref. GenBank:   NC_008396.1 (2860640..2862200)
Protein sequence: OsPrx36(LOC_Os03g05770)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   486 (469)
PWM (Da):   %s   50598.06 (48851.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.58 (4.58) Peptide Signal:   %s   cut: 18 range:18-486
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDTRLPLLLLLAGVVAAAAPLLATAQLSADFYSSTCPNVEKVVST
VIERKFKEDPTTSALLLRLLFHDCFAN
GCDASILIDPLSNQSAEKEAGPNISVKGYDIIDEIKTELEKECPQVVSCADIVALSTRDSVRLAGGPNYDVPTGRRDSLVSNREEGDSLPGPDIAVPKLMAQFSEKGFSADEMVVLLAGG
HSIGKAKCFFIEVDAAPIDPTYRSNITAFCDGKDGDKGAVPLDPITPDVVDPNYFELVMDKKMPLTIDRLMGMDARTKPIVESMGKKTDQFDATFGKAMTKLSGMKVITGKDGEIRKSCS
EFNNPVNTDDGPSVIRISSLNPEEMMGSFAPATGKSPSAASESRKVAPGGAMEERMAAGEAKTDASGGAMAERLAAGEAKTAAAASEDENQAAAGGAAGDEAAAEEEGTKSNKKKAERVT
AEVPADEAAPAAKKPRAMGGQSFSMAGAGAGGEPAKKSTAMKSQSFSMAGQPQQ*

Retrieve as FASTA  
Remarks chromosome 3. 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACCCGCCTCCCCCTCCTCCTCCTCCTCGCCGGCGTCGTCGCCGCCGCGGCGCCACTGCTCGCCACCGCCCAGCTCTCCGCCGACTTCTACTCCTCCACCTGCCCCAACGTCGAG
AAGGTCGTCTCCACCGTCATCGAGCGCAAGTTCAAGGAGGACCCTACCACCTCCGCCCTCCTCCTCCGCCTCCTCTTCCACGACTGCTTCGCCAAT
ATGTACGTTCACGTTCTACGACCT
TGCCCGCCGCCGGCAATGGCGGATGCTGACTTGCATGTGATGTTGGATGCGTGCGTGCGTGTGCGTGTGTGGGTGGTGTAGGGATGCGACGCGTCGATCTTGATCGACCCGCTGTCGAAC
CAGAGCGCGGAGAAGGAGGCGGGGCCGAACATCTCGGTGAAGGGCTACGACATCATCGACGAGATCAAGACGGAGCTGGAGAAGGAGTGCCCGCAGGTGGTGTCGTGCGCGGACATCGTG
GCGCTCAGCACGCGCGACAGCGTGCGCCTCGCCGGGGGCCCCAACTACGACGTGCCCACCGGCCGCCGCGACTCGCTCGTCTCCAACCGCGAGGAAGGCGACTCGCTCCCCGGCCCGGAC
ATCGCCGTCCCGAAGCTCATGGCGCAGTTCTCCGAGAAGGGGTTCAGCGCCGACGAGATGGTCGTCCTCCTCGCCGGCGGCCACTCCATCGGCAAGGCCAAGTGCTTCTTCATCGAGGTC
GACGCGGCGCCCATCGACCCGACCTACCGCTCCAACATCACCGCCTTCTGCGACGGCAAGGACGGCGACAAGGGAGCCGTCCCCCTTGATCCCATCACCCCCGACGTCGTCGACCCCAAC
TACTTCGAACTCGTCATGGACAAGAAGATGCCGCTCACCATCGACCGCCTCATGGGGATGGACGCAAGAACGAAGCCCATCGTGGAGTCCATGGGTAAAAAGACCGACCAGTTCGACGCC
ACCTTCGGCAAGGCCATGACGAAGCTCAGCGGCATGAAGGTCATCACCGGCAAGGACGGCGAGATCAGGAAATCGTGCTCCGAGTTCAACAACCCGGTGAACACCGACGACGGCCCGTCC
GTCATCCGGATCAGCTCGCTGAACCCCGAGGAGATGATGGGCTCCTTTGCGCCGGCCACCGGGAAGTCCCCCTCCGCCGCCTCGGAGTCCAGGAAGGTGGCACCAGGCGGCGCCATGGAG
GAAAGGATGGCGGCCGGTGAGGCGAAGACGGATGCTTCAGGCGGCGCCATGGCGGAAAGGTTGGCGGCCGGTGAGGCGAAGACGGCTGCTGCGGCCTCCGAGGATGAAAACCAAGCGGCA
GCTGGTGGCGCCGCCGGCGATGAGGCGGCGGCGGAGGAGGAGGGGACCAAGTCCAACAAGAAGAAGGCCGAGCGGGTGACCGCAGAAGTACCTGCCGACGAGGCGGCGCCGGCGGCAAAG
AAGCCGAGGGCGATGGGCGGACAATCGTTCAGCATGGCCGGCGCCGGCGCCGGCGGCGAGCCGGCGAAGAAGTCGACGGCGATGAAGAGCCAATCCTTCAGCATGGCGGGCCAGCCGCAA
CAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACACCCGCCTCCCCCTCCTCCTCCTCCTCGCCGGCGTCGTCGCCGCCGCGGCGCCACTGCTCGCCACCGCCCAGCTCTCCGCCGACTTCTACTCCTCCACCTGCCCCAACGTCGAG
AAGGTCGTCTCCACCGTCATCGAGCGCAAGTTCAAGGAGGACCCTACCACCTCCGCCCTCCTCCTCCGCCTCCTCTTCCACGACTGCTTCGCCAAT
GGATGCGACGCGTCGATCTTGATC
GACCCGCTGTCGAACCAGAGCGCGGAGAAGGAGGCGGGGCCGAACATCTCGGTGAAGGGCTACGACATCATCGACGAGATCAAGACGGAGCTGGAGAAGGAGTGCCCGCAGGTGGTGTCG
TGCGCGGACATCGTGGCGCTCAGCACGCGCGACAGCGTGCGCCTCGCCGGGGGCCCCAACTACGACGTGCCCACCGGCCGCCGCGACTCGCTCGTCTCCAACCGCGAGGAAGGCGACTCG
CTCCCCGGCCCGGACATCGCCGTCCCGAAGCTCATGGCGCAGTTCTCCGAGAAGGGGTTCAGCGCCGACGAGATGGTCGTCCTCCTCGCCGGCGGCCACTCCATCGGCAAGGCCAAGTGC
TTCTTCATCGAGGTCGACGCGGCGCCCATCGACCCGACCTACCGCTCCAACATCACCGCCTTCTGCGACGGCAAGGACGGCGACAAGGGAGCCGTCCCCCTTGATCCCATCACCCCCGAC
GTCGTCGACCCCAACTACTTCGAACTCGTCATGGACAAGAAGATGCCGCTCACCATCGACCGCCTCATGGGGATGGACGCAAGAACGAAGCCCATCGTGGAGTCCATGGGTAAAAAGACC
GACCAGTTCGACGCCACCTTCGGCAAGGCCATGACGAAGCTCAGCGGCATGAAGGTCATCACCGGCAAGGACGGCGAGATCAGGAAATCGTGCTCCGAGTTCAACAACCCGGTGAACACC
GACGACGGCCCGTCCGTCATCCGGATCAGCTCGCTGAACCCCGAGGAGATGATGGGCTCCTTTGCGCCGGCCACCGGGAAGTCCCCCTCCGCCGCCTCGGAGTCCAGGAAGGTGGCACCA
GGCGGCGCCATGGAGGAAAGGATGGCGGCCGGTGAGGCGAAGACGGATGCTTCAGGCGGCGCCATGGCGGAAAGGTTGGCGGCCGGTGAGGCGAAGACGGCTGCTGCGGCCTCCGAGGAT
GAAAACCAAGCGGCAGCTGGTGGCGCCGCCGGCGATGAGGCGGCGGCGGAGGAGGAGGGGACCAAGTCCAACAAGAAGAAGGCCGAGCGGGTGACCGCAGAAGTACCTGCCGACGAGGCG
GCGCCGGCGGCAAAGAAGCCGAGGGCGATGGGCGGACAATCGTTCAGCATGGCCGGCGCCGGCGCCGGCGGCGAGCCGGCGAAGAAGTCGACGGCGATGAAGAGCCAATCCTTCAGCATG
GCGGGCCAGCCGCAACAGTAG

Retrieve as FASTA