Entry information : EgrPrx132
Entry ID 10460
Creation 2012-02-06 (Qiang Li)
Last sequence changes 2016-01-15 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EgrPrx132
Name EgrPrx132
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx132
start..stop
S start..stop
EcamPrx132 642 0 1..329 1..333
EguPrx132 627 0 15..329 1..315
EglPrx132 535 0 1..329 1..329
PpePrx25 528 0 5..324 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67850497..67850700 204 N° 2 67850201..67850392 192 N° 3 67849014..67849607 594  
complement(join(67849014..67849607,67850201..67850392,67850497..67850700))


exon

Literature and cross-references EgrPrx132
DNA ref. GenBank:   NW_010092445.1 (67850700..67849014) Phytozome 12:   scaffold_8 (67851826..67850182)
Cluster/Prediction ref. Genebank:   104415764
Protein sequence: EgrPrx132
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (309)
PWM (Da):   %s   35917.8 (33704.6)  
PI (pH):   %s   4.55 (4.54) Peptide Signal:   %s   cut: 21 range:21-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPDLSVLFLLLLLRQTAMAVALQPGYYAETCPGAEAAVREAMKAALIREPRSVASVMRFQFHDCFVNGCDGSLLLDDTPTMVGEKEALSNINSLRSFEVIDEAKDALEKACPGVVSCADVIIMAARDAVALTGGPDWEVKLGRMDSLTASQEDSNNVMPSPRANASFLIDLFASYGLSVKDLVALSGSHSIGQARCFSIMFRLYNQSGTGRPDPAIDPGFLDELYKLCPQGVDQNVTGNLDSTPRVFDNQYFKDLVAGRGFLNSDQTLFTFPQTRAYVRRFSLDQDEFFRAFLEGMIKMGDLVSDQPGEIRRNCRVVNSRPVDGLSES*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Short 5' end is missing). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCCTGACCTGTCTGTTCTCTTCCTCCTCCTTCTCCTCCGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAGGCCGCGGTGAGG
GAAGCGATGAAGGCGGCCCTGATCAGGGAGCCCCGGAGCGTCGCCTCCGTCATGCGTTTCCAGTTCCACGACTGCTTCGTCAAT
GTAAACCGCCGAGCCACGAATCTTCTCTGCTTCTGA
ATCATCTAATTTTCTTCTCCGTTGAATCTGAATGGTTTTCGTTCTCTCGTTTTTTCTCTTCCCGAAAGGGCTGCGACGGGTCTCTTCTCCTGGACGACACGCCCACCATGGTCGGAGAGA
AAGAGGCCCTGTCCAACATCAATTCGCTGCGGTCGTTCGAAGTCATCGACGAGGCCAAGGACGCGCTGGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACGTCATCATCATGGCTG
CTCGGGACGCAGTCGCCCTG
GTGAGTAAAATCTCTTCATCTTTTTACCAACGAACAGAGCACGTCAAGAAATGACACTAAACATCATTCCAAATTGAATTTACTTTGGAAAACCAGATTT
ATGTGGACACAAAGAAGAAGAGCTGTCCTTTTAATTACTGTAGACAATGCAATGGCAATTTATGAAAATTTATAAAGTGAGATGAAAGGGAAATGACATTGGAGATATTGAATTATTTGT
TCTTTTGATTCGATGAATATATTCTGAGATGGGGTCGGCGGTTCATAAATAGGACATGCAAAAAGACAGTATTTTTTTTCCATAAATGGTGAAACTGCAGAATAATAGATATTTTGGAGC
CTAGACGGTTTTGGCTGCCGGATTTGGCAAATGGTCCCTTCTTCTAGTCCGGGTCCTGGTTCCTGAACTGGCTCGTGAGTGCGGGCCACTCTGTTTCCGGCCCTGCGAATGCGAAAGACG
ATTGATTTCGCCCGATTTTAGTCCCTAAGGTAGGACCAGGGGAAACAGGGGACATTTGCAGCGCTGATCTTAGCCTAAGAACGGACGATCAACTTTGATTTGAGTTCTAATGCAACGGAG
CTATCTTTTCTAGACCGGCGGGCCGGATTGGGAAGTGAAGTTGGGGAGGATGGACAGCCTGACGGCTAGCCAGGAGGACTCGAACAACGTAATGCCGAGCCCGAGGGCCAACGCGAGCTT
CCTTATCGATCTTTTCGCCAGCTATGGCCTCTCCGTCAAGGACCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGGTGCTTCTCGATCATGTTCCGGCTCTACAACCAGTC
AGGGACCGGCAGACCGGACCCCGCGATCGACCCAGGTTTCCTGGACGAGCTCTACAAGCTCTGCCCGCAGGGAGTCGATCAGAACGTGACGGGGAATCTGGACTCCACGCCCCGGGTGTT
CGACAACCAGTACTTCAAGGACCTGGTCGCAGGCAGAGGGTTCCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGGGCGTACGTGAGGAGGTTCAGCCTAGACCAGGACGA
GTTCTTCAGGGCTTTCCTCGAGGGGATGATCAAGATGGGGGATCTGGTGTCGGACCAGCCCGGCGAGATCAGGAGGAACTGTAGGGTGGTGAACAGCCGGCCAGTGGATGGCTTGTCGGA
ATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCCTGACCTGTCTGTTCTCTTCCTCCTCCTTCTCCTCCGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAGGCCGCGGTGAGG
GAAGCGATGAAGGCGGCCCTGATCAGGGAGCCCCGGAGCGTCGCCTCCGTCATGCGTTTCCAGTTCCACGACTGCTTCGTCAAT
GGCTGCGACGGGTCTCTTCTCCTGGACGACACGCCC
ACCATGGTCGGAGAGAAAGAGGCCCTGTCCAACATCAATTCGCTGCGGTCGTTCGAAGTCATCGACGAGGCCAAGGACGCGCTGGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGAC
GTCATCATCATGGCTGCTCGGGACGCAGTCGCCCTG
ACCGGCGGGCCGGATTGGGAAGTGAAGTTGGGGAGGATGGACAGCCTGACGGCTAGCCAGGAGGACTCGAACAACGTAATGCCG
AGCCCGAGGGCCAACGCGAGCTTCCTTATCGATCTTTTCGCCAGCTATGGCCTCTCCGTCAAGGACCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGGTGCTTCTCGATC
ATGTTCCGGCTCTACAACCAGTCAGGGACCGGCAGACCGGACCCCGCGATCGACCCAGGTTTCCTGGACGAGCTCTACAAGCTCTGCCCGCAGGGAGTCGATCAGAACGTGACGGGGAAT
CTGGACTCCACGCCCCGGGTGTTCGACAACCAGTACTTCAAGGACCTGGTCGCAGGCAGAGGGTTCCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGGGCGTACGTGAGG
AGGTTCAGCCTAGACCAGGACGAGTTCTTCAGGGCTTTCCTCGAGGGGATGATCAAGATGGGGGATCTGGTGTCGGACCAGCCCGGCGAGATCAGGAGGAACTGTAGGGTGGTGAACAGC
CGGCCAGTGGATGGCTTGTCGGAATCTTGA

Retrieve as FASTA