Entry information : EgrPrx59
Entry ID 10464
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EgrPrx59
Name EgrPrx59
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx59
start..stop
S start..stop
EglPrx59 670 0 1..332 1..332
EguPrx59 633 0 1..332 1..332
EcamPrx59 567 0 1..332 3..334
MePrx135 475 3e-170 1..331 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48127686..48127904 219 N° 2 48128753..48128926 174 N° 3 48129092..48129266 175 N° 4 48129667..48130097 431
join(48127686..48127904,48128753..48128926,48129092..48129266,48129667..48130097 )


exon

Literature and cross-references EgrPrx59
DNA ref. Phytozome 12:   scaffold_2 (48127686..48130097)
Protein sequence: EgrPrx59
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   35096.42 (32172.9)  
PI (pH):   %s   7.34 (6.01) Peptide Signal:   %s   cut: 27 range:27-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRGASFRSWSLRWVVLLICFVGGKSQLTTDFYSTSCPNLLSIVRKEVQNAIKAETRMGASLLRLHFHDCFVNGCDGSVLLDGSDGEKFAGPNLNSARGFDVVDNIKTAVESSCSGVVSCADILAIAARDSHVQSGGPTWKVPLGRRDGLVANQTGSNNGLPAPFDPLDTIISKFAAVGLNVTDVVALSGGHTIGLARCATFSNRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNKGLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSISPLTGSKGEIRKNCRVVNSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACTAGCTGTCCTAATCTG
CTTAGCATAGTAAGGAAAGAAGTTCAAAATGCTATCAAGGCTGAAACGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GTATGTCATGTGTTTAATATC
AATAACTTGATCGTTACCGTACCATGCAATCAACGACTAGGTTTTTTACGTGATCAATTATATAAATTGTTATTTCGATTTTGTGTTATTGTTCTTCTAAGTGGGCAGTTTCTTGTAATT
CGTAAATATTAATAAGCTTGAGATATCGGTTCTCTTGTTCGTAGGTTCTATGTAGACTCGAATAGGTTTTTAACAAGTGGAAATAATTAGGAGAATTTTTTTTTGAACAGGTAATTAGGA
GAATTTGAGTATAGACCTTTGTCCCTAAGCAATTTCAAATGGTAAATATGAGTAAAATGCTTTTTCGTGATTGATTTTATGTGAAACTAATATGAGCTATCATCATATGCACTTAAAATT
GAAGTCTAGCTTTTACTCTCACCCAAGACCAAGTCGAGCTATTATTAGAAACACTAGGTTCTAGGAACCCAATGCACTTGATGTGCCACGGCCGTTAAATCATGTGAATTTCCCGCAAAC
TCAAACAAAAGATTGATGCACCTGGCAAGGGACATCATTGTTTCGCAAAATAAGTTAGTGAACAAAAAAGGTACTTCTTGACCATTCCAAGAACGAGAAAGTCAATCTTCTAATCCTCTT
TTTGGAAAAGTAAGTTACCTGCATGTTAGTTTCCTCAGTCATCCTAGGACTTCCTAGTATTCCGAAGGCTAGGGATATGTATATACATCAGAACAGGACATGAGAGGCTACCCATTCAAT
CGTCCTCTTTTCCCCATCTTACATTGACTTATCAGCCCTTCATGCTTTCATCATCATTCATGGCTTATATGTTCTCCTGTGAATACTTCACTCTGCTCACACACCAGGGATGCGATGGAT
CGGTTCTCCTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGTGGTGTTG
TATCGTGTGCCGACATCTTAGCCATAGCCGCCAGAGATTCC
GTGCTCTTGGTAAGTGCCAATCTGTATGAATACGAGAAATCTAAAGAGTTTTGTCTGGATTCCACCAAAAAATACAAGA
ATCAACGGTACCCCGTAAACTATAAATAATTCGGTCCACTGTATTCATCGTAAACTCGGTAAGAAGGTAACTGTATCTGATGGATCCATGTGCAGAGCGGGGGGCCGACATGGAAAGTTC
CACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACAATGGCCTTCCTGCTCCTTTCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCA
CAGATGTGGTAGCTTTATCAG
GTACTCTTCTTTTTCTCTTCCTTTTTTCTTTCTCTCTTTGGATCAGTGCTTTATCCGGTACTTTGAGGACACTCCTCAGTCATTCTAATTTCTATACAA
ACTGCGTATTGGTATCCCTCGTTCAATCAAGAGGCTAGTTAGTGCCTACCATGTTTGATATTTTAACATCCATCTAAAATCAAAGTGATTGTAGTTACTGATCACGCTTAAATTAGGCAA
CAAAACTCTGACGGCGTTGTCACCTCTCTGTATGTTCATATCGAATCATGCAGATCTTGTTGTAAATTATAATCATTTCCAGATCCATCTGAAGTTTCCTGAGAGAGAGCATGTGCAACT
CTTAATGGTGTATAGGATGATCATTTCATGCACTGCTGAACAAAAAGAGGTTTATGTACAGGTGGTCATACAATTGGATTAGCAAGGTGCGCCACCTTCAGCAACAGATTGTTCAACTTT
TCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGACGGAAACAAGACAACGGCCCTAGACCGCAACTCAACCGAT
CTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCCAGTTCTACTACAAAAAGTCTAGTAGAA
TCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACTGGTTCAAAGGGTGAGATTCGGAAGAACTGTAGAGTGGTT
AACTCTTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACTAGCTGTCCTAATCTG
CTTAGCATAGTAAGGAAAGAAGTTCAAAATGCTATCAAGGCTGAAACGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GGATGCGATGGATCGGTTCTC
CTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGTGGTGTTGTATCGTGT
GCCGACATCTTAGCCATAGCCGCCAGAGATTCC
CATGTGCAGAGCGGGGGGCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACAATGGC
CTTCCTGCTCCTTTCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTGGTCATACAATTGGATTAGCAAGGTGCGCC
ACCTTCAGCAACAGATTGTTCAACTTTTCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGACGGAAACAAGACA
ACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCC
AGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACTGGTTCAAAGGGT
GAGATTCGGAAGAACTGTAGAGTGGTTAACTCTTCATGA

Retrieve as FASTA