1. Browse the Database
  2. View Redoxidase
Entry information : EgrPrx59
Entry ID 10464
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EgrPrx59
Name EgrPrx59
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx59
start..stop		 S start..stop
EglPrx59 670 0 1..332 1..332
EguPrx59 659 0 1..332 1..332
EcamPrx59 567 0 1..332 3..334
MePrx135 475 3.38e-170 1..331 1..328
Gene structure Fichier Exons►


exon

Literature and cross-references EgrPrx59
DNA ref. Phytozome 12:   scaffold_2 (48127686..48130097)
Protein sequence: EgrPrx59
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   35096.42 (32172.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.34 (6.01) Peptide Signal:   %s   cut: 27 range:27-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRGASFRSWSLRWVVLLICFVGGKSQLTTDFYSTSCPNLLSIVR
KEVQNAIKAETRMGASLLRLHFHDCFVNGCDGSVLLDGSDGEKFAGPNLNSARGFDVVDNIKTAVESSCSGVVSCADILAIAARDSHVQSGGPTWKVPLGRRDGLVANQTGSNNGLPAPFDPLDTIISKFAAVGLNVTDVVALSGGHT
IGLARCATFSNRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNKGLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSIS
PLTGSKGEIRKNCRVVNSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No prediction from Phytozome.
DNA ►
Send to BLAST
CDS►
Send to BLAST