Entry information : EgrPrx116
Entry ID 10467
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2013-04-04 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EgrPrx116
Name EgrPrx116
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx116
start..stop
S start..stop
EguPrx116 651 0 1..321 1..321
EcamPrx115 600 0 1..321 1..322
EguPrx115 597 0 1..321 1..322
EgrPrx115 575 0 1..321 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49734971..49735189 219 N° 2 49735324..49735515 192 N° 3 49735606..49735768 163 N° 4 49736346..49736737 392
join(49734971..49735189,49735324..49735515,49735606..49735768,49736346..49736737 )


exon

Literature and cross-references EgrPrx116
DNA ref. Phytozome 12:   scaffold_7 (49734971..49736737)
EST ref. GenBank:   HS069065.1 [5' end]   HS054560.1 [3' end]
Protein sequence: EgrPrx116
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (295)
PWM (Da):   %s   34736.19 (32103.8) Transmb domain:   %s   o10-32i
PI (pH):   %s   5.7 (5.34) Peptide Signal:   %s   cut: 27 range:27-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSSFSKAILTLACVVLLIGGTSAQLSIFYYTETCPDLFPTVQSIVQEAIAKEARMGASLLRLFFHDCFVNGCDGSNLLDDTPTFTGEKNAAPNRNSLRGFDVVDQIKSAVEEVCPSIVSCADLLAIISRDAVEILGGPGWDVKLGRRDARTAANVSIPPPTNNLSALISGFQNHGLYGLSQQDLVALYGAHTVGQARCTNFRARIYNESNIDSSFAQAMKSNCPSVTGVGDNNLDGLDYQSATSFDNTYYVNLMRKRGLLHSDQQLFNGGSTDSLIRTYAQSQDTFFKDFAASMINMGDIKPLTGSNGEIRKNCRRIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 2 ESTs. No prediction from phytozome. Incoherence between EST and DNA for the exon 3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGCCTTCTTCATTTTCAAAGGCCATTTTGACTTTGGCTTGCGTTGTGCTCCTCATCGGTGGCACGAGCGCTCAACTTTCGATTTTCTATTACACCGAAACTTGCCCCGACCTC
TTCCCGACGGTGCAGTCAATCGTGCAAGAAGCGATTGCGAAAGAGGCCCGCATGGGCGCCTCGCTCCTCCGCTTGTTCTTCCACGACTGCTTCGTCAAT
GTAACTTTTCTTCCCCCAATA
TTTATGACCAAAGTCATACATGTTTCTTAGAATTGGAAAAGCTGTTAATGCTCTTAGCTAAGAAAGAGTTTGGCTCCTTATCGCCTTTTCAACATTCATGGTTTATTTATCAGGGTTGCG
ACGGATCAAACCTCTTGGACGATACGCCTACTTTCACCGGAGAGAAGAACGCGGCCCCAAACCGAAATTCCTTGCGAGGGTTCGATGTGGTGGACCAGATTAAGTCCGCGGTGGAGGAAG
TGTGCCCCAGCATCGTCTCCTGCGCCGATTTGTTGGCGATTATCTCCCGAGATGCGGTTGAGATA
GTAAGTCATTGGAGCTAGACTAGCAATGGAGACGAAAGCCTTTGATTATTTTTGA
ATGAGTAATAATTTTGTTGCGAATGAATTGGGCAGCTGGGAGGACCAGGGTGGGACGTGAAGCTAGGAAGGAGAGATGCGAGAACCGCAGCTAACGTTAGCATTCCTCCTCCAACTAATA
ACCTCAGCGCTCTCATTTCCGGCTTCCAAAATCATGGGCTTTATGGGCTTTCTCAACAAGACCTTGTCGCTCTATACG
GTGAATTTCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCCACC
ATATGATATGTAGCATTTAATGATTTTTAGTAGGCGTGCTTTAGGGCATTCGTTAAGTAGTGTTCACTATCATACAAAATAATTTATTTGCAAAAGTCCAGGAAGATATCTGCTTCTTCT
TCTTTTTTACGAGCAAGTACTATACAAACTAAATCTCTTAGATCAAATCATTCACTTTTCAAGAATTTATGAGATCCACACTAAGCCCCACTAAAGAGCATGAGTTTTTGTGCAGTTTCT
GCATTTTAGTTGGATTTTTTATGAGTAAGACCTGCAGAGATTGTGTCTATTAGATCAAGTCAATCACATATAAAATTCTATAAGAGCCACAATGGGTCCCCAAAAAAAAAACCAAACTTT
TCATGCAACTACTACATTTTAATCAAGGTTGTCAGAAAAAAAAGAAAAAAGAAATTGGGGTTGTCCACCTTATCACTCACAAATTGAGTCTATATAGTATTCTTCATTTTATTACAATAT
TCAAATTACTCAATTTAATACTTATTTATATGCCCTTCTACTCTTAAATACTCAGGAGCGCACACAGTTGGGCAAGCGAGATGCACAAACTTCCGGGCCAGGATCTACAACGAGAGCAAC
ATCGACAGTTCATTTGCCCAGGCGATGAAGAGCAACTGCCCGAGCGTCACCGGCGTCGGCGACAACAACCTGGACGGGCTCGACTACCAGAGCGCGACATCGTTCGACAACACTTACTAC
GTCAACCTCATGAGGAAAAGAGGCCTCCTCCACTCCGACCAACAGCTCTTCAATGGCGGGTCCACCGACTCGCTCATCAGGACTTACGCCCAAAGCCAAGATACCTTCTTCAAGGACTTT
GCGGCCTCCATGATCAATATGGGCGACATCAAGCCCCTCACCGGATCCAACGGCGAGATCAGGAAGAACTGTAGGAGGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGCCTTCTTCATTTTCAAAGGCCATTTTGACTTTGGCTTGCGTTGTGCTCCTCATCGGTGGCACGAGCGCTCAACTTTCGATTTTCTATTACACCGAAACTTGCCCCGACCTC
TTCCCGACGGTGCAGTCAATCGTGCAAGAAGCGATTGCGAAAGAGGCCCGCATGGGCGCCTCGCTCCTCCGCTTGTTCTTCCACGACTGCTTCGTCAAT
GGTTGCGACGGATCAAACCTC
TTGGACGATACGCCTACTTTCACCGGAGAGAAGAACGCGGCCCCAAACCGAAATTCCTTGCGAGGGTTCGATGTGGTGGACCAGATTAAGTCCGCGGTGGAGGAAGTGTGCCCCAGCATC
GTCTCCTGCGCCGATTTGTTGGCGATTATCTCCCGAGATGCGGTTGAGATA
CTGGGAGGACCAGGGTGGGACGTGAAGCTAGGAAGGAGAGATGCGAGAACCGCAGCTAACGTTAGCATT
CCTCCTCCAACTAATAACCTCAGCGCTCTCATTTCCGGCTTCCAAAATCATGGGCTTTATGGGCTTTCTCAACAAGACCTTGTCGCTCTATACG
GAGCGCACACAGTTGGGCAAGCGAGA
TGCACAAACTTCCGGGCCAGGATCTACAACGAGAGCAACATCGACAGTTCATTTGCCCAGGCGATGAAGAGCAACTGCCCGAGCGTCACCGGCGTCGGCGACAACAACCTGGACGGGCTC
GACTACCAGAGCGCGACATCGTTCGACAACACTTACTACGTCAACCTCATGAGGAAAAGAGGCCTCCTCCACTCCGACCAACAGCTCTTCAATGGCGGGTCCACCGACTCGCTCATCAGG
ACTTACGCCCAAAGCCAAGATACCTTCTTCAAGGACTTTGCGGCCTCCATGATCAATATGGGCGACATCAAGCCCCTCACCGGATCCAACGGCGAGATCAGGAAGAACTGTAGGAGGATC
AATTAA

Retrieve as FASTA