Entry information : EgrPrx113
Entry ID 10469
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2012-02-07 (Qiang Li)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-03-19 (Catherine Mathe)
Peroxidase information: EgrPrx113
Name EgrPrx113
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx113
start..stop
S start..stop
EcamPrx113 639 0 1..315 1..315
EglPrx113 638 0 1..315 19..333
EguPrx113 636 0 1..315 1..315
EguPrx112 608 0 2..315 7..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49689478..49689681 204 N° 2 49689163..49689354 192 N° 3 49688840..49689005 166 N° 4 49688306..49688691 386
complement(join(49688306..49688691,49688840..49689005,49689163..49689354,4968947 8..49689681))


exon

Literature and cross-references EgrPrx113
DNA ref. Phytozome 12:   scaffold_7 (49689681..49688306)
Protein sequence: EgrPrx113
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (296)
PWM (Da):   %s   34000.67 (32112.6)  
PI (pH):   %s   9.99 (9.99) Peptide Signal:   %s   cut: 20 range:20-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGFSVVVVLLATSVITTARCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRKDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFRRRIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCGTCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCCGTTGTAAGCTCTCACCGAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GTGAGTCGCGTCTTCTAGAGATTCCTTGCGAAACGA
TCCCACTTTGATTCATTAGCCTTTCAGAGTTTTCCTCTTCTTTTCCTTTCTCCTCAATATTGATGTGTGTATCTACGTATTGGTCAGGGGTGCGATGCGTCGATATTGTTGGATGACACG
CCTAGCTTTGTGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCA
GATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAATTTAGTACATTTTTGC
CTCGCCGGTTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCTTGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTC
CATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCTCCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTC
TG
GTAATTTCAACTCAATATTATCACCTTTCACCGCGCATTACAACCAAGAGTATTCAAAAGAAAAAAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAACGTCGATGTACTTT
ATCAGCTGACAGCGGTTTTCCAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTCCGAAGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAAT
TGCAGAAGATATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTC
ACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTA
AGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCGTCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCCGTTGTAAGCTCTCACCGAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GGGTGCGATGCGTCGATATTGTTGGATGACACGCCT
AGCTTTGTGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCAGAT
ATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCT
CCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTC
CGAAGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGATATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACC
TTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACA
GGAAAATTTTTCCGAGATTTTGCCAAGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA