Entry information : OsPrx37(LOC_Os03g13180)
Entry ID 1047
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx37(LOC_Os03g13180)
Name OsPrx37(LOC_Os03g13180)
Class Class III peroxidase    [Orthogroup: Prx153]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx37
start..stop
S start..stop
TaPrx160-1A 473 3.68e-169 28..333 32..337
TaPrx160-1D 470 3.91e-168 28..333 32..336
TaPrx160-1B 462 3.2e-165 28..333 32..336
ZmPrx17 454 4.44e-162 28..332 25..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1047' 'join(7074745..7074963,7075050..7075241,7075339..7075932)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7074745..7074963 217 N° 2 7075050..7075241 190 N° 3 7075339..7075932 592  
join(7074745..7074963,7075050..7075241,7075339..7075932)


exon

Literature and cross-references OsPrx37(LOC_Os03g13180)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=nucleotide&cmd=search&term=BN000566&doptcmdl=GenBank
Protein ref. UniProtKB:   Q8S5Y4
DNA ref. GenBank:   NC_008396.1 (7074745..7075929)
Protein sequence: OsPrx37(LOC_Os03g13180)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (310)
PWM (Da):   %s   35613.38 (33546.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.56 (4.56) Peptide Signal:   %s   cut: 25 range:25-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAASVVVLCALVVLAAAGGASAWPVMSPSYYEASCPSVYDIVR
RVVQEARCTDPRAPASLLRLHFHDCFVN
GCDGSLLLDDFGAMQSEKNAPPNKGSARGFDVVDGIKAALENACPGVVSCADILALAAEISVELSGGPSWNVMLGRRDGTAANFEGARDLPGPTDDLDLLRRKFSEFNLDDTDFVALQGA
HTIGRAQCRFFHDRLYNISGTEQPDQTLDMAYLNELRQSCPASDPESAALRNLDPPTPDAFDNSYYGNLLRNRGLLQSDQGMLSAPGGAASTTAPIVVWFAGSQDDFFRSFATAMVKMGN
ISPLTGSMGEIRRNCRVVNRG*

Retrieve as FASTA  
Remarks chromosome 3; no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGGCTTCGGTGGTGGTGTTGTGCGCGCTGGTCGTCCTCGCGGCGGCGGGGGGCGCGAGCGCTTGGCCGGTGATGAGCCCGTCGTACTACGAGGCGTCGTGCCCAAGCGTG
TACGACATCGTGCGGCGCGTCGTCCAGGAGGCGCGCTGCACCGACCCGCGCGCCCCCGCCAGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
ATGTGCGTACAGTGTGTCCTA
GGTTGCGTGCCATGCATGGCGTTTGCGTGACATATTTGAGCTGGGATTAACGTGTTTGTGTGTGCAGGGGTGTGACGGGTCGCTGCTGCTCGACGACTTCGGCGCGATGCAGAGCGAGAA
GAACGCGCCCCCGAACAAAGGGTCGGCGCGTGGGTTCGACGTGGTGGACGGCATCAAGGCTGCCCTGGAGAACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGC
CGAGATCTCCGTCGAGCTG
TGGTCAGTCCATGCACGCACCCATGCCATCAAACATTCAATCACGCCGAACCATATAGTATCTGTGGATCGCTGACACGTACGCTTTCTTGTCGAGCAGTC
AGGAGGGCCGAGCTGGAACGTGATGCTGGGGAGGAGGGACGGCACGGCGGCGAACTTCGAGGGCGCCAGAGACCTCCCCGGACCGACGGACGATCTGGACCTCCTGAGACGGAAATTCTC
CGAATTCAACCTCGACGACACCGACTTCGTCGCTCTCCAGGGCGCGCACACCATCGGGAGGGCGCAGTGCAGGTTCTTCCACGACCGGCTCTACAACATCAGCGGCACGGAGCAGCCGGA
CCAGACGCTGGACATGGCCTACCTCAACGAGCTCCGGCAGAGCTGCCCGGCGAGCGACCCCGAAAGCGCGGCGCTGCGCAACCTCGACCCGCCCACGCCGGACGCGTTCGACAATAGCTA
CTACGGCAACCTCCTGCGCAACCGCGGCCTGCTCCAGTCCGACCAGGGGATGCTCTCCGCGCCGGGCGGCGCCGCCTCGACCACCGCGCCCATCGTCGTGTGGTTCGCCGGTAGCCAGGA
CGACTTCTTCAGGAGCTTCGCGACGGCGATGGTCAAGATGGGCAACATCAGCCCGCTCACCGGGAGCATGGGGGAGATCAGGAGGAACTGCAGGGTGGTCAACCGCGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGGCTTCGGTGGTGGTGTTGTGCGCGCTGGTCGTCCTCGCGGCGGCGGGGGGCGCGAGCGCTTGGCCGGTGATGAGCCCGTCGTACTACGAGGCGTCGTGCCCAAGCGTG
TACGACATCGTGCGGCGCGTCGTCCAGGAGGCGCGCTGCACCGACCCGCGCGCCCCCGCCAGCCTCCTCCGCCTCCACTTCCACGACTGCTTCGTCAAT
GGGTGTGACGGGTCGCTGCTG
CTCGACGACTTCGGCGCGATGCAGAGCGAGAAGAACGCGCCCCCGAACAAAGGGTCGGCGCGTGGGTTCGACGTGGTGGACGGCATCAAGGCTGCCCTGGAGAACGCCTGCCCCGGCGTC
GTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCGAGATCTCCGTCGAGCTG
TCAGGAGGGCCGAGCTGGAACGTGATGCTGGGGAGGAGGGACGGCACGGCGGCGAACTTCGAGGGCGCC
AGAGACCTCCCCGGACCGACGGACGATCTGGACCTCCTGAGACGGAAATTCTCCGAATTCAACCTCGACGACACCGACTTCGTCGCTCTCCAGGGCGCGCACACCATCGGGAGGGCGCAG
TGCAGGTTCTTCCACGACCGGCTCTACAACATCAGCGGCACGGAGCAGCCGGACCAGACGCTGGACATGGCCTACCTCAACGAGCTCCGGCAGAGCTGCCCGGCGAGCGACCCCGAAAGC
GCGGCGCTGCGCAACCTCGACCCGCCCACGCCGGACGCGTTCGACAATAGCTACTACGGCAACCTCCTGCGCAACCGCGGCCTGCTCCAGTCCGACCAGGGGATGCTCTCCGCGCCGGGC
GGCGCCGCCTCGACCACCGCGCCCATCGTCGTGTGGTTCGCCGGTAGCCAGGACGACTTCTTCAGGAGCTTCGCGACGGCGATGGTCAAGATGGGCAACATCAGCCCGCTCACCGGGAGC
ATGGGGGAGATCAGGAGGAACTGCAGGGTGGTCAACCGCGGCTGA

Retrieve as FASTA