Entry information : EgrPrx[P]89
Entry ID 10473
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EgrPrx[P]89
Name EgrPrx[P]89
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]89
start..stop
S start..stop
EcamPrx[P]89 531 0 10..291 1..283
BvPrx02 414 1.39e-146 1..291 74..365
NnPrx65 412 2.98e-146 1..291 26..317
CclPrx113 412 4.44e-146 1..291 27..318
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10473' 'join(5056782..5056916,5057439..5057627,5058002..5058167,5058331..5058713)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5056782..5056916 133 N° 2 5057439..5057627 187 N° 3 5058002..5058167 164 N° 4 5058331..5058713 381
join(5056782..5056916,5057439..5057627,5058002..5058167,5058331..5058713)


exon

Literature and cross-references EgrPrx[P]89
DNA ref. Phytozome 12:   scaffold_6 (5056782..5058713)
Protein sequence: EgrPrx[P]89
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   290 (320)
PWM (Da):   %s   30820.01 (35156.7)  
PI (pH):   %s   4.51 (7.31) Peptide Signal:   %s   cut: 22 range:22-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SANFYVSSCPLALSIIQDAVNTVASSEPRMGASLPRLHFHDCFVNGCDGSVLLDDTDGFTGEKTAGGNVNSIRGLDVVDYIKTRLEEQCPGIVSCADILAAAARDSVVLGGPTWTVQLGRRDSTTASLSAANSDIPSPLSDLNVLISDFAEKGFSAKEMVALSGT
HMIGRARSFLFRARIYNEENINPTFATS*RQNCPGAGGDDNLVPLETGDGDMFDNNYFKDLVSMKGLLHSDQQLFNNGSADRQVKAYSLDSASFFADLADAMVKMGNLSPLTGTDGEVRT
NCRKV

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short 5' end is missing and Stop in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCGAACTTTTACGTGAGCTCGTGTCCTTTGGCTCTGTCCATTATCCAGGACGCCGTGAACACGGTGGCGTCCTCAGAGCCCCGAATGGGAGCCTCGCTTCCGCGTCTTCACTTCCAC
GATTGCTTTGTCAAT
ATGCAAGTTCTATTTTTACTCTTCATGTGTCGTCTTCATCATCAAAGTTCCACCGAAGACATCACTTTGCCATGGCAGATCCAGAACTTAGTATTCAATCCGTGG
GTTAAATAGTAGATCGAACACTTGTGTTACAGTTTGAGCCCAGACAAGTTTTCAATCAACTTTGTATGCTTCCGAGAACCTTTCATGAGGAGCACAGTAAGACGAACCTAGCATTATACA
ATTCCCTGCGCGGAAAAAAAAAAAAAAAAAAAACACATGACTAGGTTCACGCTGCCACTTCATACAAACGAAAGACGAAAAATGAGGCGAGTCTTCAGTAAATGTCACGACCCAATTTCG
TATCGCGTTGTTTTTCCTAGATTATAAATGTCATATTCAGTCCTAGTCGATTCTTCTGCTTCCGTCCAAGCTGCTTTATCTGTCGAACTTTGTTCAAGCATAGAGGGAGCAAACGAGGTT
GAAGCAAAAGCTTAATGGCTTGTCCACAAAAAAATCTAATGATATCGAGGTTTAAACAGGGTTGCGACGGGTCTGTGTTGTTGGACGACACGGATGGATTCACCGGCGAGAAGACGGCTG
GCGGCAATGTAAATTCAATCAGGGGTTTGGACGTGGTCGACTACATCAAGACTCGGCTTGAAGAACAATGCCCTGGGATCGTATCGTGTGCTGACATCCTAGCCGCCGCAGCCCGCGATT
CTGTCGTT
TTGCGGTAAGATGCCTTTTCTACTTGTATAGAAACACGAGATACCCTTCTGATCATCTCTCGAAAAAGAAGGGAGACCGAAAATCTCTCGATAAGCTCTCATTTCTTCTTAA
CACGGCATGACAAACCAATTAATATTCTCATAAAATATAGTGGTTATGTGCTCCAACAATTATAGATTCTCCATATTGATTGGTCAGACATGGCAGTATTGGCAAAGAATATTACTTTCC
ATGCCCATGGCGATGCATTAATCGATGATTTCGGAAAATATGTTACTCCAAGTATAGTCTTATATCCCTTTTTTCATCAACAAGACAGAAGGTGATTATGATCAGATTGATTATACTAAT
TGGGGATCATGCAATAATTTTCAGTTGGGTGGACCTACGTGGACCGTTCAACTAGGCAGGAGAGATTCAACCACGGCAAGTTTGAGCGCTGCAAACAGCGATATTCCTTCGCCCCTCTCG
GACCTTAATGTTCTCATATCTGACTTCGCTGAGAAGGGATTCTCTGCCAAAGAAATGGTCGCCCTCTCAG
AGGTGTTTCATCTAATTTACTTGGCCTTGGCAAAAAATGTCATTAATCTA
AGAGAGAAGTATCGTTCTTTTGGTCTTCGCACTCTGGAAAGGCTTTCTCTGATTGTTGCTGAAAGAAAATCGCCCGACTATGATCCACCGTCGTACATGCGCTTTTGTGCCGCAGGAACT
CACATGATAGGCCGAGCGAGGAGCTTCCTGTTCCGTGCTCGCATCTACAACGAGGAGAACATCAACCCCACATTCGCCACGTCGTAGAGGCAGAACTGTCCCGGTGCAGGCGGGGATGAT
AATCTCGTGCCGCTTGAGACCGGCGACGGTGACATGTTCGACAATAACTACTTCAAGGACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACAACGGATCCGCC
GACAGGCAGGTGAAGGCCTACAGCCTCGACTCGGCCTCCTTCTTCGCCGATCTGGCCGATGCCATGGTGAAGATGGGGAACCTCAGCCCCCTCACAGGAACGGATGGGGAAGTCAGGACC
AACTGCAGGAAAGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCGAACTTTTACGTGAGCTCGTGTCCTTTGGCTCTGTCCATTATCCAGGACGCCGTGAACACGGTGGCGTCCTCAGAGCCCCGAATGGGAGCCTCGCTTCCGCGTCTTCACTTCCAC
GATTGCTTTGTCAAT
GGTTGCGACGGGTCTGTGTTGTTGGACGACACGGATGGATTCACCGGCGAGAAGACGGCTGGCGGCAATGTAAATTCAATCAGGGGTTTGGACGTGGTCGACTAC
ATCAAGACTCGGCTTGAAGAACAATGCCCTGGGATCGTATCGTGTGCTGACATCCTAGCCGCCGCAGCCCGCGATTCTGTCGTT
TTGGGTGGACCTACGTGGACCGTTCAACTAGGCAGG
AGAGATTCAACCACGGCAAGTTTGAGCGCTGCAAACAGCGATATTCCTTCGCCCCTCTCGGACCTTAATGTTCTCATATCTGACTTCGCTGAGAAGGGATTCTCTGCCAAAGAAATGGTC
GCCCTCTCAG
GAACTCACATGATAGGCCGAGCGAGGAGCTTCCTGTTCCGTGCTCGCATCTACAACGAGGAGAACATCAACCCCACATTCGCCACGTCGTAGAGGCAGAACTGTCCCGGT
GCAGGCGGGGATGATAATCTCGTGCCGCTTGAGACCGGCGACGGTGACATGTTCGACAATAACTACTTCAAGGACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTC
AACAACGGATCCGCCGACAGGCAGGTGAAGGCCTACAGCCTCGACTCGGCCTCCTTCTTCGCCGATCTGGCCGATGCCATGGTGAAGATGGGGAACCTCAGCCCCCTCACAGGAACGGAT
GGGGAAGTCAGGACCAACTGCAGGAAAGTTAAT

Retrieve as FASTA