Entry information : OsPrx38(poxN / LOC_Os03g13210)
Entry ID 1048
Creation 2006-08-23 (Filippo Passardi)
Last sequence changes 2006-08-23 (Filippo Passardi)
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-01-25 (Catherine )
Peroxidase information: OsPrx38(poxN / LOC_Os03g13210)
Name OsPrx38(poxN / LOC_Os03g13210)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx38
start..stop
S start..stop
SbPrx19 500 5e-180 33..335 30..332
BdiPrx45 495 3e-178 1..335 1..334
SiPrx153 493 2e-177 31..335 30..332
ZmPrx13 491 2e-176 31..335 30..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7097529..7097768 240 N° 2 7097114..7097296 183 N° 3 7096817..7096982 166 N° 4 7096088..7096506 419
complement(join(7096088..7096506,7096817..7096982,7097114..7097296,7097529..7097 768))


exon

Literature and cross-references OsPrx38(poxN / LOC_Os03g13210)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q5
DNA ref. GenBank:   NC_008396.1 (7097768..7096091)
Protein sequence: OsPrx38(poxN / LOC_Os03g13210)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (302)
PWM (Da):   %s   35058.34 (31732.7) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.11 (6.10) Peptide Signal:   %s   cut: 34 range:34-335
Sequence 376
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEYATRGDRTASCLSFLCNIVVLLGLAAAAASGQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDGTNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVLLGRRDGLVANQTGANSNLPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLFSNRLANFSATNSVDPTLDSSLASSLQQVCRGGADQLAALDVNSADAFDNHYYQNLLANKGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQIRKNCRAVN

Retrieve as FASTA  
Remarks chromosome 3. 8 ESTs.

Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACGCTACTCGTGGAGATCGCACGGCTAGCTGCCTGAGTTTCCTCTGCAATATCGTCGTTCTGCTGGGCCTCGCCGCCGCGGCGGCGAGCGGGCAGCTGACGGACGACTACTAC
GACTATTGCTGCCCCCAGGTTTACCGCATCGTCCGGTCCCGCGTGGCCGCCGCGATGAAGGCCGAGATGCGCATGGGCGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCAAT
GTAATCATCCAACTATTTTATTTTTCCCCTTTTTCTGCTGCTCATTGCAGTGCGCTAGATACACTACGTGCATGCAAGTCGCATTCAAAACGTACACATACCGAAACAAGAAAATGAAAT
TAACGATCTCAATTAACCTGTATAGAGGACTCTGAACTTTCATGTGATATATGTTACTGAACTTCAGAGACTGAACTCTGAACTTCTTACCGACACACTGTGAATTCTGCAGGGCTGTGA
CGCGTCCATCCTCCTTGACGGCACAAACAGCGAGAAGTTCGCGGCGCCGAACAACAACTCGGTGAGAGGGTACGAAGTCATCGATGCGATAAAGGCCGACCTCGAGAGCGCCTGCCCGGG
AGTCGTCTCCTGCGCCGACATAGTAGCCCTTGCAGCTAAATACGGAGTACTACTT
GTACGTTCCTATGTCTCGAATGGAGGGATGAAAATTCATCTTTGATAGTAAAGCACTATAGTATT
ACCAATCGAGCAAAAGAACAATTGATTTTTCAGTCATGCTGAATATATCTGTGTTGGTCTTTGCAGAGTGGAGGACCTGATTATGATGTCCTCCTGGGAAGAAGAGATGGTCTGGTGGCA
AATCAGACGGGGGCGAACAGTAACTTGCCTAGCCCTTTCGATTCGATCAGCGTTATCACTGCGAGGTTCAAGGATGTCGGTCTCAACGCAACCGATGTTGTGGTCTTATCAG
GTACCTCT
ATCTATCTCCTATATCTTCATGCATCGAGCAAAAATTACCTCGTCAATTCTTCAATCAAACATTGATTGGGATTTGACAAATGAATTGATAAAGACACAAATTATGATATCAATAACGAT
GTCGCATCTACTCTACTCGGTGTGGCATGCATAGCAGTTTACGTGGATTATGCATGATTTAGCATTTGTCAGATCAAAAACTAGTTTCTGCACCAATTTGTTACTCCCTCCGTTTCAAAA
TATAGTTATGTTTGGCTACGAATCAATCCAAGACTGATCTGAACTCTTCTGAACCTGAACAGGGGCGCACACGATCGGGCGATCTCGCTGCCTGCTGTTCAGCAACCGGCTGGCGAACTT
CTCGGCGACCAACTCCGTCGACCCGACGCTGGACTCGTCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGCGGCGGCGCTGACCAGCTGGCGGCGCTGGACGTCAACTCCGCCGACGCGTT
CGACAACCACTACTACCAGAACCTGCTGGCCAACAAGGGCCTCCTCGCCTCCGACCAGGGCCTCGTCTCCAGCTCCGGCGACCCCGCCGTCGCCGCCACCAAGGCGCTGGTGCAGGCCTA
CAGCGCCAACGGCCAGCGCTTCTCCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCAGCCCTCTCACCGGCTCTGCCGGCCAGATTCGCAAGAACTGCAGGGCCGTCAACTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACGCTACTCGTGGAGATCGCACGGCTAGCTGCCTGAGTTTCCTCTGCAATATCGTCGTTCTGCTGGGCCTCGCCGCCGCGGCGGCGAGCGGGCAGCTGACGGACGACTACTAC
GACTATTGCTGCCCCCAGGTTTACCGCATCGTCCGGTCCCGCGTGGCCGCCGCGATGAAGGCCGAGATGCGCATGGGCGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCAAT
GGCTGTGACGCGTCCATCCTCCTTGACGGCACAAACAGCGAGAAGTTCGCGGCGCCGAACAACAACTCGGTGAGAGGGTACGAAGTCATCGATGCGATAAAGGCCGACCTCGAGAGCGCC
TGCCCGGGAGTCGTCTCCTGCGCCGACATAGTAGCCCTTGCAGCTAAATACGGAGTACTACTT
AGTGGAGGACCTGATTATGATGTCCTCCTGGGAAGAAGAGATGGTCTGGTGGCAAAT
CAGACGGGGGCGAACAGTAACTTGCCTAGCCCTTTCGATTCGATCAGCGTTATCACTGCGAGGTTCAAGGATGTCGGTCTCAACGCAACCGATGTTGTGGTCTTATCAG
GGGCGCACACG
ATCGGGCGATCTCGCTGCCTGCTGTTCAGCAACCGGCTGGCGAACTTCTCGGCGACCAACTCCGTCGACCCGACGCTGGACTCGTCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGCGGC
GGCGCTGACCAGCTGGCGGCGCTGGACGTCAACTCCGCCGACGCGTTCGACAACCACTACTACCAGAACCTGCTGGCCAACAAGGGCCTCCTCGCCTCCGACCAGGGCCTCGTCTCCAGC
TCCGGCGACCCCGCCGTCGCCGCCACCAAGGCGCTGGTGCAGGCCTACAGCGCCAACGGCCAGCGCTTCTCCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCAGCCCTCTC
ACCGGCTCTGCCGGCCAGATTCGCAAGAACTGCAGGGCCGTCAACTG

Retrieve as FASTA