Entry information : OsPrx41(LOC_Os03g22010)
Entry ID 1051
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx41(LOC_Os03g22010)
Name OsPrx41(LOC_Os03g22010)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx41
start..stop
S start..stop
SiPrx122 415 1.05e-146 7..320 23..338
SbPrx17 403 2.72e-142 24..320 23..318
BdiPrx42 402 1.21e-141 30..320 34..321
TaPrx206-1A 396 1.44e-139 14..320 10..315
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1051' 'join(12583131..12583346,12583805..12583996,12584185..12584350,12587760..12588148)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12583131..12583346 214 N° 2 12583805..12583996 190 N° 3 12584185..12584350 164 N° 4 12587760..12588148 387
join(12583131..12583346,12583805..12583996,12584185..12584350,12587760..12588148 )


exon

Literature and cross-references OsPrx41(LOC_Os03g22010)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q2
DNA ref. GenBank:   NC_008396.1 (12583131..12588145)
Protein sequence: OsPrx41(LOC_Os03g22010)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (298)
PWM (Da):   %s   33291.55 (31210.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.98 (6.98) Peptide Signal:   %s   cut: 23 range:23-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYSYSSAAVAVSVLVVALAAAASGQLSTTFYASSCPTALSTIRS
AVNAAVAREPRMGASLLRLHFHDCFVQ
GCDASILLADNATFRGEQGAFPNVNSLRGFEVISSIKMQLEASCRQTVSCADILAVAARDSVVALGGPSYPVELGRRDGMTTNQTMANTNLHPPTTDLGNFVTSFAGKGLSPTDLVVLTG
AHTVGVAQCTNFRSRLYGESNINAPFAASLRASCPQAGGDTNLAPLDSTPNAFDNAFFTDLIAGRGLLHSDQELYRGDGSGTDALVRVYAANPARFNADFAAAMVRMGAIRPLTGTQGEI
RLNCSRVN

Retrieve as FASTA  
Remarks chromosome 3. No EST. TC264607
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTACTCCTACTCTTCCGCCGCCGTGGCGGTGAGCGTTTTGGTGGTGGCGTTGGCGGCGGCGGCGTCGGGCCAGCTGTCGACGACGTTCTACGCCTCGTCGTGCCCGACCGCGCTG
TCGACGATCAGGAGCGCCGTGAACGCGGCGGTGGCCAGGGAGCCCCGCATGGGCGCCTCCCTGCTCAGGCTCCACTTCCACGACTGCTTTGTCCAA
AAGCAAGTCTCATCCATTAGTCTT
AAAATCTTAATTATTACTCCTGCCCCTATACTTAATTCTCTATTGCTTTATATGATTTTTTTACTTAATTCTCTATTGCTTTATATGATTTTTTTTCCGATTACATGATAGACACATGCC
ACTACACACGTAACACTATACTTATATATCCACGAATGTGTCCTCATAACACACGCTTAAAGAGATATATTCTTGATCTCAGTGAAATTCTATTGGGATATACTACTAACATGAATTGGC
TAGGTAGGATGTTGTGATTTACAGGCCAGGGTGTTTGGTTCACGATAACACTTTACCACACCACATTTTTTTGTTGTCACAGTTTATTAGACATATACTTTATACTTTGTTCAGTGTAAC
CGTTATGGCTTATTCACATTTTTTTCAATAGCATGTCTCTTATGTCATAGACTTAATTTTCTTACCAATTTCATAGGGATGCGACGCGTCGATACTGCTGGCCGACAATGCCACCTTCCG
GGGGGAGCAGGGTGCGTTCCCTAATGTCAACTCGCTGAGGGGATTCGAGGTCATCTCTAGCATTAAGATGCAACTCGAGGCATCTTGCAGGCAGACCGTCTCCTGCGCCGACATCCTTGC
TGTCGCCGCCCGCGACTCCGTCGTCGCC
CCGTACGTCGATCCCAAGCTTGCTAGCTTGTCTCAAATTAATTGAACGCAACAACTCTCTCCGTCCTGTAAAAGACAAATCTCAAATGAGAT
GTGACACATTCTAATACTACGAATCTGGATATAAGATAGTAGATTTATTTTTTTTAGACGAAGAGAGCAGCCATTAACATTGTACGACATGGATGCAGCTAGGAGGTCCATCGTACCCGG
TGGAGCTCGGGAGGAGGGACGGGATGACGACGAACCAAACCATGGCGAACACCAACCTCCATCCACCGACCACCGACCTGGGTAACTTCGTCACTAGCTTCGCCGGGAAAGGGCTCAGCC
CCACCGACCTGGTTGTACTCACTG
TGGTAATTAAGGCTCCCATTTCTGGTTAATTAATTACTTACTCGTTTCCCTGAGTACGATTTCCTAAACTACATTTTGTAAGTATTATATATACAT
ATTTTAATAAAAGAAATCAAATAATTTTATTTTTAAATTTATAATAGTTAATACTTAATTAATTAATTAATTATACGGTAATAACTTGTTATGTTTTGCGTGAGGCTAAAAAGCTCAGTT
CATAAGCATATTCGAATGCACCCTAAGTACTAAGCTGCATGGGGCAAGCTATATGTCACTCAAGTGTTCTTTTTTTAAAATCGCACGAATGTAATCACTATTTTTTTACAGTAAAACCAA
CCATGCATATGTGAAGCTTGACCGTAATGTAGTGGATGAGTGAGCGATGAAACTAGGTCCAACCTAACAGCTTCATCGGTTTTTTAAAGAAATATCAAATCTAAGGAAAAATCAGAGGTA
CGAACCATGCGATTTTTAAGGAAAAAAAATTCACACGAGATAGATATATAGCGAATTCGATCTGCAGTAACATATACTCCCTCCGTTTCGAAATGTTTGACGTCATTGACTTTTTAGCAC
ATGTTTGACCATTCGTCTTATTCAAAAAAATTAAGTAATTATTAATTCTTTTCCTATCATTTGATTCATTGTTAAATATATTTTTATGTAGGCATATAATTTTACATATTTCATAAAAGT
TTTTGAATAAGACGAACAATCAAACATGTGCTAAAAAATCAATGGTGTCAAACATTTTAAAATGAAGGATGTAGTATATAAGCTCTCCTACTACATAAGTAGGCCTCTTGTTGCGTGGAT
TAGATAGCTACGGCCCACGGTTATCTGCAGCGGCTTTTTTTTGTGTTCAGTAGATCCAAGCTGATCGATATCAAACAGCTAGACCAACGTATACTAGCTAATTAAAATTAGAAAGGACGT
GGATTTTTATCTCTCGAGGGGATATCCTCTCGTTGCTTGTATATAATCTAAATAGTTATTAAAAAATTTAAAATAAAATATATCACTTCACAAACAAATATGTAAGGTCAAATTCGATTT
ATACCTAAGGTCAATTTACGAAGGGTTAATTTGAGTTGTTTCAGCTTTAATATACGTGTGTAGATGCCACATCAAACTGGTTAATTAGCTGGTGAAAGCAACGGTTTTCTTTATCGTTAG
TTGGAAAAATAAATCAGCAGTAGTGCAACAGCAGGAGGCTGCCACTTTCTTCCTTGGAGATGGTGGTCAGGTGAGTACCACCGCCACATTGTTGTCACGTGTCTGTGTCTATTGCTCTGT
ATTCCCAACCTCTTCTGCCTAGTTTCCCTCGTATTCCGCGCGCACGCTTTTCAAACTGCAAAATGGTGAGTTCTTTTATAAAATTTCTATATGAAATTTGTTTAAAAAATCATAATGGTG
AGTTCTTTTATAAAATTTCTATATGAAAGTTGTTTAAAAAATCATATTGATCCATTTTTTTTAAAAAAATATTAATACTTAATTAATCACGTGCTAATAAACTGCTCCGTTTTTCGTGCA
CTGAAAATGTGTTGGGAACTGGAGAAACGATCACACTCTTCTGGATCCTTCTCGTGCCTCTTAGCTTTTGATCAATCCAAGCCGTCCTTCCTTAATCCAATGGCTAATATAATGTTGTAT
ATGTGGCACAATGACAGAGGGAATAAACATTCTACGTTCATATTATGATGATGATTTCTATGACGGAGATCATTAACTAATTTTGCTTGAAACTGTCCACGTAATTGTCTATACGTTGGA
AACGTGATTATTTTTTAATTAGATTTGTCAAACTTTCCTGTGTTTATGGATACTTGTTAATGTTGGTTGGAAGTACTATATATAGGTGTAAATGTTGGATGTTGAATCAATATTGATTAA
AGTGAGTCCAAAAAAGGTTGATTTAAAGTATAGTAGAAATAGGTTTTCAAAAATAAATCAGTCCCCTTTCATAATCAAGAAAACAACATATATGTCCTGTAGAATGTGACGCATTCGTTG
CATAGTGTTTCTTATAAGTCCTTTTCGTTGATAGGATTTGTTCACTGAATGTGACCAAGTAACTAACTCAGGTACCCTACACTCAATTATCCCCTCATATCGCTAATCTTCTGTGCGAAA
CTGGGATATGCTTAAGTCAACCACCGCCTTTGCTCCTCATCAAATGTCGGTGCATGTAGTGTTAAAATACGATTATTGGCCTTATCGAGTTGGTTCCTATTTATTTACAACCGTAAATTA
AAGTTTTTTTTAAGAAATATTAAACTAAAATTCAATTGTGTAAGCATGTTTTTATCGGAATTTGACCGGTTTTAGATAATAACCACTCAGTTATCACAGTTTTTAATAAAACCACTGGGG
AAATGGTTTTTTTTCTCTTCTCTACAACTATTAAAAACACTCCTCATCCCTTTCCCCTCACTCGCGTAGTCGCGTGTAGCGCATTAAAAAAAATCGCTAGATACAAACTGTTGCTACATG
CTAAAAAAATCACTAGAATTGAAAAAAACCCAAAAGAAAAAGAAAAAGAAAAAGAAAAGCGGTTGGATAAATAATATCTTGTTTTATACTTAGATTCACATTTTATGCCCTAGCCTATTT
TCAATGGTATGGTCATGTTTCAATGCCCGAACATATCAATTAGTAGGAGTAGCTTTTTTTTAACGGATTTACTAGAAGAACTTTTTCTAGCTTTCGAATTTCCAGCCATAAGATGTTGTG
TTAAGATTCGTGCTATACTATTTACATATAAGTTAGTTACAGTTAGTTACTACACCGTAACTACATTATAACTTCTATATAATGGGGACATATCCGGTGAAAAACATCAAATAAGTTAAA
ACCCGTAAAAACTATATCTAAAAGTTCGTGAATTCATGAAAAAATTATTAGAGATAGGTATAGGCATGAAATACATTCATACCAAAACTCAGTCCAAACTCAACTTCATTTGAGAGAAAC
AAAAAGACAAATTTCTGGTGAACAGTAACAGGACACTATTCATTCACTCGAAATTTGTTTTTTTTTCTCTCAAATGAAGTTGAGTTTGGACTTGAGATTTTGTATGAATGTATTTCATGC
CTATACCTATCTCTAATAATTTTTTCATGAATTCACAAACTTTTAGATATAGTTTTCACGGGTTTTCATTTATTTGATGGTTTTCACCGGATATTCCTCCTATATAATTTAGGTATAAAA
GACTGTATTTATTTTATATATACAAGTTATAATATTATAGTGTTATAGTATAATTATGGTGAAATTATATTATATAGTTACATTTAAAAGTTTTTCAATAAAAAAGCTTGCGACGATTTT
AATGAAGGAACATTTCTGCAAACGTCTGACACAATTAAGTGGATCTTCTGGCTACTACTGTAACTACACATGCAGGAGCGCACACGGTGGGCGTGGCGCAGTGCACCAACTTCCGGTCGC
GGCTCTACGGCGAGTCCAACATCAACGCGCCGTTCGCGGCGTCGCTCCGGGCGAGCTGCCCGCAGGCCGGCGGCGACACCAACCTGGCGCCGCTGGACTCCACCCCCAACGCCTTCGACA
ACGCCTTCTTCACCGACCTCATCGCCGGCCGCGGCCTCCTCCACTCCGACCAGGAGCTCTACCGCGGCGACGGCTCCGGCACCGACGCCCTCGTCCGCGTCTACGCCGCCAACCCCGCCC
GCTTCAACGCCGACTTCGCCGCCGCCATGGTGCGCATGGGCGCCATCAGGCCGCTCACCGGCACGCAGGGCGAGATCAGGCTCAACTGCTCCAGGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTACTCCTACTCTTCCGCCGCCGTGGCGGTGAGCGTTTTGGTGGTGGCGTTGGCGGCGGCGGCGTCGGGCCAGCTGTCGACGACGTTCTACGCCTCGTCGTGCCCGACCGCGCTG
TCGACGATCAGGAGCGCCGTGAACGCGGCGGTGGCCAGGGAGCCCCGCATGGGCGCCTCCCTGCTCAGGCTCCACTTCCACGACTGCTTTGTCCAA
GGATGCGACGCGTCGATACTGCTG
GCCGACAATGCCACCTTCCGGGGGGAGCAGGGTGCGTTCCCTAATGTCAACTCGCTGAGGGGATTCGAGGTCATCTCTAGCATTAAGATGCAACTCGAGGCATCTTGCAGGCAGACCGTC
TCCTGCGCCGACATCCTTGCTGTCGCCGCCCGCGACTCCGTCGTCGCC
CTAGGAGGTCCATCGTACCCGGTGGAGCTCGGGAGGAGGGACGGGATGACGACGAACCAAACCATGGCGAAC
ACCAACCTCCATCCACCGACCACCGACCTGGGTAACTTCGTCACTAGCTTCGCCGGGAAAGGGCTCAGCCCCACCGACCTGGTTGTACTCACTG
GAGCGCACACGGTGGGCGTGGCGCAG
TGCACCAACTTCCGGTCGCGGCTCTACGGCGAGTCCAACATCAACGCGCCGTTCGCGGCGTCGCTCCGGGCGAGCTGCCCGCAGGCCGGCGGCGACACCAACCTGGCGCCGCTGGACTCC
ACCCCCAACGCCTTCGACAACGCCTTCTTCACCGACCTCATCGCCGGCCGCGGCCTCCTCCACTCCGACCAGGAGCTCTACCGCGGCGACGGCTCCGGCACCGACGCCCTCGTCCGCGTC
TACGCCGCCAACCCCGCCCGCTTCAACGCCGACTTCGCCGCCGCCATGGTGCGCATGGGCGCCATCAGGCCGCTCACCGGCACGCAGGGCGAGATCAGGCTCAACTGCTCCAGGGTCAAC
TGA

Retrieve as FASTA