Entry information : EgrPrx[P]57
Entry ID 10510
Creation 2012-02-15 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-02-28 (Qiang Li)
Peroxidase information: EgrPrx[P]57
Name EgrPrx[P]57
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]57
start..stop
S start..stop
EguPrx[P]57 387 8e-140 1..205 1..205
EglPrx[P]57 262 4e-91 1..205 1..150
EcamPrx[P]57 262 6e-91 1..153 1..164
EcamPrx176 198 2e-63 66..205 186..325
EcamPrx176 99 2e-25 3..75 63..132
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20371097..20371153 57 N° 2 20370837..20371004 168 N° 3 20368938..20369210 273 N° 4 20368805..20368921 117
complement(join(20368805..20368921,20368938..20369210,20370837..20371004,2037109 7..20371153))


exon

Literature and cross-references EgrPrx[P]57
DNA ref. Phytozome 12:   scaffold_2 (20371153..20368805)
Protein sequence: EgrPrx[P]57
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   203 (177)
PWM (Da):   %s   22578.59 (19492.8)  
PI (pH):   %s   8.64 (7.96) Peptide Signal:   %s   cut: 31 range:27-203
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRLH*ERTFIRRIISLLHSILLDLTANNKAEKAAVPNRSLTGFDVIDKIKEKLEKTCPLVVSCVDILILAARDSSGGHTIGVGHCNFFSNRLYNFTSKGDQDLSRDQDLSLDPTYASQLKAQRKTHSNNVTTLAMDPGSPLSFNSHYYTALNPN*GLFQSDTMLLLLDQDGFFTEFRQLMKQRGALQVLMGSDGEIRKKCNVIN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame, Gaps in frame). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGATTGCACTGAGAACGCACATTCATTAGAAGAATCATTTCATTGCTTCATATCATTGTCACATGGTCGTAGAAAGAGAGTTTCGCATGGTAATGTTTCATCGGTGTTTGATCG
GATCGCTTCATGTGTGTAGGGTTGCAAGCTCGATTTTGCTAGATTTGACGGCAAACAACAAGGCGGAGAAGGCGGCAGTTCCGAACCGGTCGCTAACTGGGTTTGATGTAATAGACAAGA
TCAAGGAGAAGCTAGAGAAAACATGCCCCCTCGTCGTCTCTTGTGTTGACATCCTCATTTTAGCTGCTCGAGACTCT
GGTCTCTATCCAAGTAAGACTTTTCGAGGCGATGAAAACTCTT
GGACCATTCATTGGCATTCTTTTGAGTGTGTTTCAACACTTTTGGAAGCTTTTCTTCTCGAGTTAGTAGAACTTTAGTAACCTCGTCGACCCTCCTCGACATGTGCTCTTGAACAAAACT
ATTGTGGAAAAAAGCTTTTTTGGAGCATTCCATGGCGACACTAGACTATCAAGCAAAAATTCATCTGTCTTCTTTGATACTATTTTCAACCGCACAAATACGTCAAAGTCAACCGTATTT
TGATTCGTGATCAATCCATAGACAATAAAAACTACATAGGCATCATAACTTATCGGGAAAAATACAAAAAAAAAAATAAAATCATAAACCTATTGCATTGGTACAAATTCAATTATAAAC
TTTTTAATTGAACCAATTTAGTCTTAAACATTTCTACATTAGTACTAATTCAATCCATCTAACTAATTTAGCCCGGATAAATAATTAGACAAATGCAAAAACAACATCATTTTGCTAATG
ATGTGGATAAATAATTAATATAAAAATTAATTAAATTAAATTTAAAATGAAATTAAAAAGGAGAGGAAGAAGATGAACAGTTGAAGGCGGCTGAGAGCTCAACCCTCGCCACCGATGCCT
CCTTGAGATCACCAGGTTGGGCCGGGCTAACCCTTCCCCCACCGTCATCGGCCCTTCTCGATGACGGTGGGGAGTCAGTGGCGATGTGGGCGGAGCCCTCAACTGCCTCCAACTGTTCAT
CTTCTTGCTTCCTCTCTTTTTTTGAAAAAAGAATTCGTTTTATATTTAATTTAATGAATTTTTATATTAAAATTCAAATTCACGCCAAAATGACGTCGTTTTTGCATTTCTTTGCTAAGT
CAGCTTTCTAGTGAGTCACACAACCGAGCAAGATTAATAAAAATTACCACGTAAGATTTTCTGCGAGGTTCGTTGGAGGTGATATTTAAGTGTCACTTTCCACCTTACCAAATAAATTTC
ACCTTACCAAAAGAAAAATGTGTCATTTTCTTAATTTTTGGCACTTAAGTGTCCCTTTATGCCAAATTTTAGTATTTGGACTATACTTTTGCTCACAATAATTTTATCAAGTTGTCTCAC
TAAAAAATATATAATGGAATATCTTTTTTTTTTTTTTTCCAAATAAACCAAAGTATAGCATTGAAGTCCGTGGTGAAATTATCCGCATTCTTTTTTATCTGGTGTAACGGAGTGTAATTA
CAAAGAATTCTTTTATTTAGTTACTTCACAAATAAGTTACTATCCTAATGATACGATCATTGTCAACTAATAACGGTGTAAGTCGGACCCCACTTTTTATATTATATAGGATGGGCAACT
AGAGCACAGTATTCGTAATTTCAATATTTCCTATTTATATAGATTTTGGTTTCCCAATGAGAGAAACATAGCATGTTGACATTACAAGTGAAAAAAAAAAAAAACACTCCATCAAAAACA
CCCAAGCTTTCTCGACTTGAACAAGACACAGACTTGGACATTCACTTGACATTACGCGAGGACAAACTAACGACTAATCAAAATAAGAAGAGCAGTTGAATTAATTAGTTAATTAATTAA
GTATAAACTACATTTCTGGGTCATCAGGTGGGCACACAATTGGGGTCGGGCACTGCAACTTCTTCAGCAACCGGCTCTACAACTTTACCAGCAAAGGCGACCAAGACCTTTCCCGCGACC
AAGACCTTTCCCTCGACCCGACCTACGCCTCTCAATTGAAGGCCCAGCGCAAGACGCACTCCAATAACGTCACCACCCTCGCGATGGACCCCGGAAGCCCCCTCTCCTTCAACAGCCACT
ACTACACAGCCTTGAACCCAAATTAGGGCCTCTTCCAATCCGACACCATGCTTCTG
AGCGACAATCGACATGTTGCTGGACCAGGATGGCTTCTTCACCGAGTTCAGGCAGTTGATGAAG
CAGAGGGGCGCACTTCAGGTGCTTATGGGGAGCGACGGCGAGATCCGGAAGAAATGTAATGTGATTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGATTGCACTGAGAACGCACATTCATTAGAAGAATCATTTCATTGCTTCATTCGATTTTGCTAGATTTGACGGCAAACAACAAGGCGGAGAAGGCGGCAGTTCCGAACCGGTCG
CTAACTGGGTTTGATGTAATAGACAAGATCAAGGAGAAGCTAGAGAAAACATGCCCCCTCGTCGTCTCTTGTGTTGACATCCTCATTTTAGCTGCTCGAGACTCT
TCAGGTGGGCACACA
ATTGGGGTCGGGCACTGCAACTTCTTCAGCAACCGGCTCTACAACTTTACCAGCAAAGGCGACCAAGACCTTTCCCGCGACCAAGACCTTTCCCTCGACCCGACCTACGCCTCTCAATTG
AAGGCCCAGCGCAAGACGCACTCCAATAACGTCACCACCCTCGCGATGGACCCCGGAAGCCCCCTCTCCTTCAACAGCCACTACTACACAGCCTTGAACCCAAATTAGGGCCTCTTCCAA
TCCGACACCATGCTTCTG
TTGCTGGACCAGGATGGCTTCTTCACCGAGTTCAGGCAGTTGATGAAGCAGAGGGGCGCACTTCAGGTGCTTATGGGGAGCGACGGCGAGATCCGGAAGAAA
TGTAATGTGATTAAC

Retrieve as FASTA