Entry information : EgrPrx122(Eucgr.H00891 / Egrandis_v1_0.041562m)
Entry ID 10511
Creation 2012-02-15 (Qiang Li)
Last sequence changes 2013-10-30 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-03-28 (Catherine )
Peroxidase information: EgrPrx122(Eucgr.H00891 / Egrandis_v1_0.041562m)
Name EgrPrx122(Eucgr.H00891 / Egrandis_v1_0.041562m)
Class Class III peroxidase    [Orthogroup: Prx219]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx122
start..stop
S start..stop
EglPrx122 617 0 1..316 1..315
EcamPrx122 613 0 1..316 22..337
EguPrx122 609 0 1..316 1..309
EgrPrx121 521 0 6..316 31..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 143137..143289 153 N° 2 142045..142842 798  
complement(join(142045..142842,143137..143289))


exon

Literature and cross-references EgrPrx122(Eucgr.H00891 / Egrandis_v1_0.041562m)
DNA ref. Phytozome 12:   scaffold_8 (11066591..11065327)
Protein sequence: EgrPrx122(Eucgr.H00891 / Egrandis_v1_0.041562m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316
PWM (Da):   %s   34254.45  
PI (pH):   %s   9.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPPLKVGYYLRTCPLAENIIKQTVFNAVSRNPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGNPAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRNSALFTGGIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGISHCSSFSSRLYAFNATHAQDPTLDRAYAAFLKIKCPPPSNKTQPDPTVPLDSITANTLDNKYYIQLLQRRGLLTSDETLYTSPSTSGLVVNNTRNGYTWSWKFAKAMVKMGSIEVLTGNQGEIRKVCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCCCCCTAAAGGTGGGATACTACCTCCGTACTTGCCCGTTGGCAGAAAATATCATCAAGCAAACCGTGTTCAATGCTGTCTCGAGGAACCCTGGGATGGCGGCCGGTCTT
GTTCGCCTGCATTTTCACGACTGCTTCGTTAGG
GTACGGTGAGTATTTATGCTCAAAAGTTTTCCCTTAATCGACTTATTTCGCTTTCTTTAAATATTTATTTCTTCCCTTTTGAGTAAT
TCCCTTTGCTTTATACTTGAAATGATTGGAAGGAAAATGTTGAAAGTGTTCTAGAGAATTTGCTAAGACTCTTAAAATATGTATTGGAAATGTAAATTTTTATTATGAGGCATATAGTTT
CTTTTGTATCGTGTGTGTGCGCGTGTGTATGGTTGATAGTTATTTTGTGATTTCTATACTCTTACTGACTTTCTAGACTTATCTCAGGGCTGTGATGCTTCAGTGCTCTTGAAATCAACC
CCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGGTTTGAAATCATCGACCAGGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGGACAGTCTCGTGTGCC
GACATCGTCGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAACAGTGCCCTATTCACTGGGGGCATAATCTACGACGTCCCTGCTGGCCGCCGCGACGGCCGTGTCTCTCGC
CTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTCATTGCCAACTTCGCTAGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGAGCGCACTCG
ATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCCACCCACGCCCAAGATCCTACCTTGGACCGTGCGTACGCCGCTTTCCTGAAGATCAAGTGCCCGCCA
CCGAGCAACAAGACCCAACCGGACCCAACCGTGCCGCTCGATAGCATCACAGCCAACACTCTGGACAACAAGTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACTTCCGACGAG
ACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACACGAGGAATGGCTATACTTGGAGCTGGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGAAGTGCTCACT
GGTAATCAAGGAGAGATCAGGAAGGTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTCCCCCCCTAAAGGTGGGATACTACCTCCGTACTTGCCCGTTGGCAGAAAATATCATCAAGCAAACCGTGTTCAATGCTGTCTCGAGGAACCCTGGGATGGCGGCCGGTCTT
GTTCGCCTGCATTTTCACGACTGCTTCGTTAGG
GGCTGTGATGCTTCAGTGCTCTTGAAATCAACCCCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGG
TTTGAAATCATCGACCAGGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGGACAGTCTCGTGTGCCGACATCGTCGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAACAGT
GCCCTATTCACTGGGGGCATAATCTACGACGTCCCTGCTGGCCGCCGCGACGGCCGTGTCTCTCGCCTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTC
ATTGCCAACTTCGCTAGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGAGCGCACTCGATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCC
ACCCACGCCCAAGATCCTACCTTGGACCGTGCGTACGCCGCTTTCCTGAAGATCAAGTGCCCGCCACCGAGCAACAAGACCCAACCGGACCCAACCGTGCCGCTCGATAGCATCACAGCC
AACACTCTGGACAACAAGTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACTTCCGACGAGACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACACGAGGAAT
GGCTATACTTGGAGCTGGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGAAGTGCTCACTGGTAATCAAGGAGAGATCAGGAAGGTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA