Entry information : PoVP01_PC9 (VP1)
Entry ID 10516
Creation 2012-02-21 (Christophe Dunand)
Last sequence changes 2017-04-28 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-28 (Catherine Mathe)
Peroxidase information: PoVP01_PC9 (VP1)
Name (synonym) PoVP01_PC9 (VP1)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP01_PC9
start..stop
S start..stop
PoVP01_PC15 729 0 1..358 1..358
PoVP01_IFO30160 725 0 1..358 1..358
PpulVP01 702 0 1..358 1..359
PoVP03_PC9 578 0 1..348 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3293685..3293748 64 N° 2 3293500..3293633 134 N° 3 3293390..3293448 59 N° 4 3293198..3293335 138
N° 5 3293019..3293140 122 N° 6 3292891..3292966 76 N° 7 3292804..3292840 37 N° 8 3292740..3292747 8
N° 9 3292608..3292688 81 N° 10 3292484..3292553 70 N° 11 3292405..3292414 10 N° 12 3292310..3292345 36
N° 13 3292076..3292248 173 N° 14 3291979..3292018 40 N° 15 3291892..3291920 29  
complement(join(3291892..3291920,3291979..3292018,3292076..3292248,3292310..3292 345,3292405..3292414,3292484..3292553,3292608..3292688,3292740..3292747,3292804. .3292840,3292891..3292966,3293019..3293140,3293198..3293335,3293390..3293448,329 3500..3293633,3293685..3293748))


exon

Literature and cross-references PoVP01_PC9 (VP1)
DNA ref. JGI genome:   scaffold_2 (3293748..3291892)
Cluster/Prediction ref. JGI gene:   137760   115087 [Incorrect prediction]
Protein sequence: PoVP01_PC9 (VP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (336)
PWM (Da):   %s   37869.74 (35579.5)  
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 23 range:23-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFASLSALVLAFAATVQVAQAVSLPQKRATCAGGQVTANAACCVLFPLMEDLQKNLFDDGACGEDAHEALRLTFHDAIGFSPSRGVMGGADGSVITFSDTEVNFPANLGIDEIVEAEKPFLARHNISAGDLVHFAGTLAVTNCPGAPRIPFFLGRPPAKAASPIGLVPEPFDTITDILARMDDAGFVSVEVVWLLSAHSVAAADHVDETIPGTPFDSTPNLFDSQIFIETQLRGISFPGTGGNHGEVQSPLKGEMRLQSDHLFARDDRTSCEWQSMTNDQQKIQDRFSDTLFKMSMLGQNQDAMIDCSDVIPVPAALVTKPHLPAGKSKTDVEQACATGAFPALGADPGPVTSVPRV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (14 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGCTTCGCTTTCTGCGCTCGTCCTTGCCTTCGCTGCGACTGTCCAAGTCGCTCAAGGTGAGCCACCGCGGCCCTTTCTACTGATTAGGCTAACACGACGTGCTTCAGCTGTG
TCTTTGCCTCAGAAACGCGCAACTTGTGCTGGCGGACAAGTTACCGCCAACGCGGCCTGTTGTGTCCTCTTCCCGCTCATGGAAGACCTACAGAAGAACTTGTTCGACGACGGCGCATGC
GGCGAAGAT
GTACGCTCACTCAATTTACTACGACCCCTTACTTATTGCTATCTATGCCAGGCGCATGAAGCCCTTCGCCTGACGTTCCACGACGCCATTGGATTCTCTCCTTCTAGGGGG
TAGGTCTTCGCCCATTTTGTATTGCGTGCCTGTTATTGATTTGTCGAGGACAGCGTTATGGGAGGTGCCGACGGCTCTGTCATCACATTCTCTGATACTGAGGTTAACTTCCCTGCCAAC
CTTGGTATCGATGAGATCGTCGAAGCTGAGAAACCGTTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GTACGCTATTCACTGGCATATTTGAGACTGAGGATCGACACTCACTACT
TTCCGCAGGGTTCACTTCGCCGGCACCCTCGCCGTTACCAACTGTCCTGGTGCTCCGCGAATCCCGTTCTTCTTAGGTCGCCCTCCAGCCAAGGCCGCATCACCCATTGGATTAGTTCCG
GAACCATTCG
GTAAGCCGCTGTTTTCGTGACTTTGCCGCAGACTGCTAACGACTTTGAATAGATACCATCACAGATATCCTGGCCCGAATGGATGACGCTGGATTCGTCTCTGTCGAGGT
TGTCTGGCTCCTTTCCGC
GTACGCTAGACACCATTCGATCCCGAAACTATGGCTGACATAGCGTACAGGCACTCTGTCGCTGCAGCTGATCATGTTGACGAAACTGTAAGCATTACCCCA
AAAATTAACGATGTTCGAAGCTGACTTCACTTTTTGTAAAGATTCCTGGGTAAATTGTGCATACTAGCTTATTATTCTCTTGTGGCTCACACGCACTCAGAACGCCGTTCGACTCAACGC
CAAACCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGCGGAATTTCCTTCCCAGG
GTAATCAATTCTCCTAATGCCCAATCCACGTACATATTGCTTACTTGTTGATAGCACTG
GTGGGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAAATGAGACTCCAGTCAGATCACTTG
GTTAGTCTTTACATTGCCCTCTTGCACTGAGAAGCGATCTCTAACATGACATGCG
TACCGATTTGACAGTTCGCTCGAGGTACTTGAAACTATTCATTCATAATAATATTTCCCCATTGAAACATCCAAATGTATCAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAG
TAAGTATCATGTTCTATCGCTTCCATTTCTCCTCCTAAGCTCACTATCAACGATAATTAGACGATCAACAGAAGATTCAAGACCGCTTCTCCGACACGCTGTTCAAGATGTCGATGCTTG
GACAAAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCCGTCCCCGCTGCCCTTGTAACCAAACCCCATCTCCCCGCCGGGAAGAGCAAGACCGACGTTGAACAAGCC
GTACGTC
GCGCACTGTATCAGAGATCTCGCAACGTCGCTGAATTGTTTCCTCTCCAGTGTGCCACTGGCGCCTTCCCTGCTCTCGGTGCTGACCCTGGTGAGTAAGCAGGCGATGTAGACACCAGAA
AACCTCTTACCCTTTGATTCTTCTTTAGGCCCAGTCACTTCTGTTCCTCGTGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTTCGCTTCGCTTTCTGCGCTCGTCCTTGCCTTCGCTGCGACTGTCCAAGTCGCTCAAGCTGTGTCTTTGCCTCAGAAACGCGCAACTTGTGCTGGCGGACAAGTTACCGCCAAC
GCGGCCTGTTGTGTCCTCTTCCCGCTCATGGAAGACCTACAGAAGAACTTGTTCGACGACGGCGCATGCGGCGAAGAT
GCGCATGAAGCCCTTCGCCTGACGTTCCACGACGCCATTGGA
TTCTCTCCTTCTAGGGG
CGTTATGGGAGGTGCCGACGGCTCTGTCATCACATTCTCTGATACTGAGGTTAACTTCCCTGCCAACCTTGGTATCGATGAGATCGTCGAAGCTGAGAAACCG
TTCCTTGCAAGGCACAACATCTCCGCAGGCGATTT
GGTTCACTTCGCCGGCACCCTCGCCGTTACCAACTGTCCTGGTGCTCCGCGAATCCCGTTCTTCTTAGGTCGCCCTCCAGCCAAG
GCCGCATCACCCATTGGATTAGTTCCGGAACCATTCG
ATACCATCACAGATATCCTGGCCCGAATGGATGACGCTGGATTCGTCTCTGTCGAGGTTGTCTGGCTCCTTTCCGCGCACTCT
GTCGCTGCAGCTGATCATGTTGACGAAACT
ATTCCTGGAACGCCGTTCGACTCAACGCCAAACCTTTTCGATTCACAAATCTTCATCGAGACGCAACTCCGCGGAATTTCCTTCCCAGGC
ACTGGTGGGAATCACGGCGAAGTACAATCCCCACTCAAGGGTGAAATGAGACTCCAGTCAGATCACTTG
TTCGCTCGAGACGATAGGACATCCTGCGAATGGCAGTCCATGACTAACGAT
CAACAGAAGATTCAAGACCGCTTCTCCGACACGCTGTTCAAGATGTCGATGCTTGGACAAAACCAGGACGCCATGATCGATTGCTCCGATGTCATCCCCGTCCCCGCTGCCCTTGTAACC
AAACCCCATCTCCCCGCCGGGAAGAGCAAGACCGACGTTGAACAAGCC
TGTGCCACTGGCGCCTTCCCTGCTCTCGGTGCTGACCCTGGCCCAGTCACTTCTGTTCCTCGTGTGTAA

Retrieve as FASTA