Entry information : PoVP02_PC9 (VP2)
Entry ID 10520
Creation 2012-02-22 (Christophe Dunand)
Last sequence changes 2012-04-18 (Catherine Mathe)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-24 (Nizar Fawal)
Peroxidase information: PoVP02_PC9 (VP2)
Name (synonym) PoVP02_PC9 (VP2)
Class Versatile peroxidase    [Orthogroup: VP002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP02_PC9
start..stop
S start..stop
PoVP02_PC15 736 0 1..364 1..364
PoVP02_Florida 735 0 1..364 1..364
PerVP02 654 0 1..351 1..357
PoVP05_PC9 524 0 1..364 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 637325..637382 58 N° 2 637136..637269 134 N° 3 637020..637081 62 N° 4 636817..636966 150
N° 5 636639..636760 122 N° 6 636516..636591 76 N° 7 636425..636461 37 N° 8 636361..636368 8
N° 9 636229..636309 81 N° 10 636106..636175 70 N° 11 636042..636051 10 N° 12 635956..635991 36
N° 13 635719..635895 177 N° 14 635625..635660 36 N° 15 635542..635566 25 N° 16 635476..635488 13
complement(join(635476..635488,635542..635566,635625..635660,635719..635895,6359 56..635991,636042..636051,636106..636175,636229..636309,636361..636368,636425..6 36461,636516..636591,636639..636760,636817..636966,637020..637081,637136..637269 ,637325..637382))


exon

Literature and cross-references PoVP02_PC9 (VP2)
DNA ref. JGI genome:   scaffold_8 (637382..635476)
Cluster/Prediction ref. JGI gene:   137766
Protein sequence: PoVP02_PC9 (VP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (344)
PWM (Da):   %s   38263.09 (36278.0)  
PI (pH):   %s   4.29 (4.24) Peptide Signal:   %s   cut: 21 range:21-364
Sequence 406
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFAKLSALVLALGATVALGAPSLNKRVTCATGQTTANEACCALFPILEDIQTNLFDGAQCGEEVHESLRLTFHDAIAFSPALTNAGQFGGGGADGSMIIFSDTEPNFHANLGIDEIVEAQKPFIARHNISAADFIQFAGAIGVSNCAGAPRLNFFLGRPDATQIPPDGLVPEPFDSVDKILSRMGDAGFSTVEVVWLLSSHTIAAADLVDPSIPGTPFDSTPSTFDSQFFLETMLQGTAFPGTPGNQGEVESPLAGEMRLQSDFLLARDSRSACEWQSMVNNMPKIQNRFTQVMRKLSLLGHNQADLIDCSDVIPVPKTLTKAATFPAGKSQADVEIVVAATPFPALASDPGPVTAVPPVPPS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTAAACTTTCCGCTCTCGTCTTGGCTCTTGGTGCTACTGTCGCGCTTGGTGAATTACCAACCCATCTCGGGCGGAACACTGCCAGACTAATCGTTTTCAACAGGCGCACC
TAGTCTTAACAAACGCGTCACTTGTGCCACTGGCCAAACGACCGCCAACGAGGCTTGCTGCGCCCTGTTCCCGATTCTAGAGGACATACAGACCAACCTCTTTGACGGTGCCCAATGTGG
TGAAGAG
GTAGATACCTCTTCGTATTTGTATACCTGGCCGCTAACGCATAGTAATGTCCAGGTGCACGAGTCCCTGCGCTTGACATTCCACGACGCGATTGCATTCTCCCCAGCATTGAC
CAA
GTAACGTCAACCAGTTTGATTATCGCGCCAGCTGTACTCACAGTTATCTTCAGCGCTGGCCAGTTCGGAGGCGGTGGTGCGGACGGTTCTATGATCATCTTCAGTGACACCGAGCCC
AATTTCCATGCCAACCTGGGCATCGATGAAATTGTTGAAGCACAGAAGCCGTTTATCGCTCGTCACAACATCAGTGCTGCCGACTT
GTGCGTCGCGACACTTTCCCTCGTCATAAGAATT
AGCACTCAAAATTATCTTCTAGCATTCAATTCGCTGGTGCCATCGGCGTCAGCAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCCTGGGTCGCCCCGATGCCACCCAGATTCCACCTG
ATGGTCTTGTCCCAGAGCCTTTCG
GTATTACCCTTAACCTATACTACGTCGTCAACTCATTTGGCCTTCAGATAGCGTGGATAAGATTCTTAGCAGGATGGGTGACGCTGGATTTAGCAC
CGTTGAAGTCGTCTGGCTGCTTTCCTC
GTAAGCTATCTTCGGCATATATCCACCTTCTAGAAATCAATGATATTTCGACAGCCACACTATCGCTGCAGCCGATCTTGTTGACCCCTCCGT
AAGTGACCCTTTGCCAAGCTCGATGTTTTCGCTAGTTGACCTCATTGTGCATAGATTCCTGGGTAAAGGTGTTCTCGCTCGTGACATATTCCCCACTAATAATAAATCCTTAGAACTCCC
TTCGACTCAACTCCATCTACGTTCGACTCTCAATTCTTCCTGGAGACAATGTTGCAAGGGACCGCCTTCCCAGG
GTAACTGTTCATCGCTGATGCTGTCGGGATCGTAGTGCTAACTTGA
AGTTCAGAACCCCAGGCAACCAGGGTGAAGTTGAGTCGCCTCTCGCAGGTGAAATGAGACTCCAATCCGACTTCTTGGTATGTTACTCTAGACCGATGCAGAGCCACAGTTCTGATACCT
CTCCCGTATAGCTTGCCCGAGGTAATATTCATATCGCTTAGTCAGATACATCCGCTAAACATCAACTACAGACTCCAGGAGTGCCTGTGAATGGCAGTCCATGGTCAGTAAGTACTACGT
TCCCGTGTCTATATTTGATCGTTGTGGGATCTAATAAAACGACTTAGACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAGGAAGCTTTCTCTCCTCGGTCACAACCAGGC
TGATCTCATCGACTGCTCTGATGTTATTCCTGTTCCCAAGACGCTCACCAAGGCCGCCACCTTCCCCGCTGGCAAGAGTCAGGCTGATGTCGAGATCGTGGTAG
GTCTTATCGCGTATTG
CAGAATAATTGTTACCCACTATCTCCGTACAGTGCAATGCAGCTGCTACACCCTTCCCAGCTCTCGCCAGCGACCCCGGTAAGTTCCTTCAGCCCTCAACCAGTCTTTGCATAGCTAACT
GGCTTCGGTTTTATAGGCCCAGTCACCGCCGTTCCTCCCGTGTACGCCCCACATCTCGCTCTTCACTTATTCAACAAGCTAACATATTGTGCAGCCCGCCTTCGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTAAACTTTCCGCTCTCGTCTTGGCTCTTGGTGCTACTGTCGCGCTTGGCGCACCTAGTCTTAACAAACGCGTCACTTGTGCCACTGGCCAAACGACCGCCAACGAGGCT
TGCTGCGCCCTGTTCCCGATTCTAGAGGACATACAGACCAACCTCTTTGACGGTGCCCAATGTGGTGAAGAG
GTGCACGAGTCCCTGCGCTTGACATTCCACGACGCGATTGCATTCTCC
CCAGCATTGACCAA
CGCTGGCCAGTTCGGAGGCGGTGGTGCGGACGGTTCTATGATCATCTTCAGTGACACCGAGCCCAATTTCCATGCCAACCTGGGCATCGATGAAATTGTTGAAGCA
CAGAAGCCGTTTATCGCTCGTCACAACATCAGTGCTGCCGACTT
CATTCAATTCGCTGGTGCCATCGGCGTCAGCAACTGCGCTGGTGCTCCCCGCTTGAACTTCTTCCTGGGTCGCCCC
GATGCCACCCAGATTCCACCTGATGGTCTTGTCCCAGAGCCTTTCG
ATAGCGTGGATAAGATTCTTAGCAGGATGGGTGACGCTGGATTTAGCACCGTTGAAGTCGTCTGGCTGCTTTCC
TC
CCACACTATCGCTGCAGCCGATCTTGTTGACCCCTCCATTCCTGGAACTCCCTTCGACTCAACTCCATCTACGTTCGACTCTCAATTCTTCCTGGAGACAATGTTGCAAGGGACCGCC
TTCCCAGG
AACCCCAGGCAACCAGGGTGAAGTTGAGTCGCCTCTCGCAGGTGAAATGAGACTCCAATCCGACTTCTTGCTTGCCCGAGACTCCAGGAGTGCCTGTGAATGGCAGTCCATG
GTCA
ACAACATGCCGAAGATCCAGAACAGATTCACCCAAGTCATGAGGAAGCTTTCTCTCCTCGGTCACAACCAGGCTGATCTCATCGACTGCTCTGATGTTATTCCTGTTCCCAAGACG
CTCACCAAGGCCGCCACCTTCCCCGCTGGCAAGAGTCAGGCTGATGTCGAGATCGTGGTAG
CTGCTACACCCTTCCCAGCTCTCGCCAGCGACCCCGGCCCAGTCACCGCCGTTCCTCCC
GT
CCCGCCTTCGTA

Retrieve as FASTA