1. Browse the Database
  2. View Redoxidase
Entry information : PoVP03_PC15
Entry ID 10523
Creation 2012-02-22 (Christophe Dunand)
Last sequence changes 2012-02-22 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-04-16 (Christophe Dunand)
Peroxidase information: PoVP03_PC15
Name PoVP03_PC15
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP03_PC15
start..stop		 S start..stop
PoVP03_PC9 724 0 1..361 1..361
PoVP01_PC15 600 0 1..360 1..361
PoVP01_IFO30160 596 0 1..360 1..361
PpulVP01 595 0 1..360 1..362
Gene structure Fichier Exons►


exon

Literature and cross-references PoVP03_PC15
DNA ref. JGI genome:   scaffold_04 (214530..212622)
Cluster/Prediction ref. JGI gene:   156336
Protein sequence: PoVP03_PC15
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (338)
PWM (Da):   %s   37492.73 (35292.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.31 (4.31) Peptide Signal:   %s   cut: 23 range:23-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFASLSALVLALGAALQAVNAVTLPQKRATCAGGQVTANAACCVLFPILEDLQQNLFDGGECGEEVHESLRLTFHDAIGFSPTKGGGGADGSVLTFSDPEVNFPANLGIDEIVEAQKPF
LARHNISAGDLVQFAGALGVSNCPGAPRIPFFLGRPPAKAASPIGLVPEPFDTVTDILDRMGDAGFAAVEVVWLLSSHTIAAADHVDESIPGTPFDSTPSIFDSQFFIETQLRGTSFPGS
GGNHGEVESPLAGEIRLQSDHLLARDSRTSCEWQSMVDNMPKIQNRFAATMLKMSLLGQNQADLIDCSDVIPTPPALVGKAHLPAGKVQSDVEQACATTPFPAIAADPGPVTAVPPVPPS
*

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST