Entry information : OsPrx43(LOC_Os03g25300)
Entry ID 1053
Creation 2006-09-18 (Filippo Passardi)
Last sequence changes 2006-09-18 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx43(LOC_Os03g25300)
Name OsPrx43(LOC_Os03g25300)
Class Class III peroxidase    [Orthogroup: Prx056]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor Pathogen interaction
Best BLASTp hits
Perox score E-value OsPrx43
start..stop
S start..stop
OsPrx42 657 0 1..323 1..323
OsPrx44 558 0 1..323 1..323
TaPrx219-1B 539 0 1..323 1..324
TaPrx219-1D 536 0 1..323 1..324
Gene structure Fichier Exons


exon

Literature and cross-references OsPrx43(LOC_Os03g25300)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q0
DNA ref. GenBank:   NC_008396.1 (14278725..14279803)
Protein sequence: OsPrx43(LOC_Os03g25300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   34266.34 (32068.3)  
PI (pH):   %s   8.26 (8.20) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASGMKLAVAVACALALASACHGLQLGYYKQSCPRVEAIVRDEV
KKFVYKDAGIGAGLIRLVFHDCFVE
GCDGSVLLDPTPANPKPEKLSPPNMPSLRGFEVIDAAKDAVEKVCPGVVSCADIVAFAARDAAYFLSRFRVKINVPGGRLDGRRSLDSDALNNLPPPNFNVNQLIGAFAAKGLDAEDMVV
LSGAHTVGRSHCSSFVSDRVAAPSDINGGFANFLKQRCPANPTSSNDPTVNQDAVTPNAFDNQYYKNVVAHKVLFASDAALLTSPATAKMVSDNANIPGWWEDKFAKAFVKMASVGVKTG
YPGEIRRHCRVVN*

Retrieve as FASTA  
Remarks chromosome 3; 21 ESTs (UniGene Os.19737),
(http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=13165030) and AU184429 (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=14192218). Probable sequencing errot (poor resolution) in AU184429. Accessions AU173827 and AU184429 have the same homology to OsPrx42 and OsPrx43!!
DNA
Send to BLAST
CDS
Send to BLAST