Entry information : HanAPx-CcP01 (hpox7 / HanAPx-CcP01)
Entry ID 10572
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanAPx-CcP01 (hpox7 / HanAPx-CcP01)
Name (synonym) HanAPx-CcP01 (hpox7 / HanAPx-CcP01)
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanAPx-CcP01
start..stop
S start..stop
HanAPx-CcP02 770 0 2..537 1..537
HanAPx-CcP03 632 0 19..537 22..538
HC14APx-CcP03 367 1.09e-121 21..537 26..551
HEC38APx-CcP02 363 7.3e-120 24..536 30..551
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10572' 'join(468375..468595,468656..468810,468871..469201,469270..469567,469625..469671,469727..470021,470087..470350)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 468375..468595 219 N° 2 468656..468810 153 N° 3 468871..469201 329 N° 4 469270..469567 296
N° 5 469625..469671 45 N° 6 469727..470021 293 N° 7 470087..470350 262  
join(468375..468595,468656..468810,468871..469201,469270..469567,469625..469671, 469727..470021,470087..470350)


exon

Literature and cross-references HanAPx-CcP01 (hpox7 / HanAPx-CcP01)
DNA ref. JGI genome:   scaffold_02 (468375..470350)
Cluster/Prediction ref. JGI gene:   168564
Protein sequence: HanAPx-CcP01 (hpox7 / HanAPx-CcP01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   536 (516)
PWM (Da):   %s   56945.67 (54820.5)  
PI (pH):   %s   4.83 (4.82) Peptide Signal:   %s   cut: 21 range:21-536
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRGVASLVIPLSISLLSDGYQRPDTVYDALEDLYTVNSGLGSSNFIAGVSPCSFAPANTRTTGRQAAAEWVRTAYHDMATADVEAGTGGIDASITFETDRAENVGDAFNASFNFFVGFQ
NKRVSMSDLIALGTVYAVRACSGPSISYRAGRIDATGPGSKGVPEPQGDLATHTASFAKQGFNVSEMIGLVACGHTLGGVHEQDFSTIVQGETNADNNTSGMQHFDDSFDSFDNHIAVQW
MNSSTSTNTLATGFNTTTNSDARIFAADGNATMRDLASNNQVFQDRCAYLLSRMIHTVPKGVQLTDVITPIPVKPWLAQLSIDNNGKLQFEGYIRIFSTNKSQSPRDYAVNMTWTDHNGA
ACDGCSATARFPGLFSGSFWGAVALFHFNITIDPSVGFSAFSVEYTNTPGGPLTKADNDGAGFPFDDVAVLHKSASCIANDGSVKAVVAIRNDQKIMSAYIIATSAVKQAGSIARKLSTA
FVNVTESGPSLSSLYTLYSAEFNVGLVENASFDLVVETGGKTHITDFVRPNGFQSC*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACGGGGTGTAGCAAGCCTTGTCATCCCGCTATCTATTTCACTCCTTTCAGACGGATACCAAAGGCCAGATACTGTCTACGACGCTCTCGAGGATTTGTACACGGTGAACAGCGGA
CTGGGTTCCAGCAATTTCATTGCAGGGGTTTCACCATGCAGTTTCGCTCCGGCTAATACCAGGACTACTGGCAGGCAAGCTGCTGCTGAGTGGGTCCGCAC
ACGTGAGTACCACTATACT
CCCGATGAAGTTGATGATTTAAATCGAGGACGGCGGCCTATAGTGCGTACCATGATATGGCTACGGCAGATGTGGAAGCTGGCACTGGTGGAATTGATGCCTCTATCACTTTTGAGACCG
ATCGCGCAGAAAATGTCGGTGATGCTTTCAACGCCAGCTTCAATTTCTTTGTCGGGTTCCAAAACAAGCGTGTATCCA
CAGTAAGTTTGATTTATTTTTACACGCGTTACCTGTTATCTG
CTCATTGATCAAATTCTTAGTGTCTGACCTCATCGCACTCGGAACTGTTTATGCTGTCCGTGCATGCTCAGGGCCTTCCATATCTTACCGGGCCGGTCGTATCGATGCCACAGGGCCTGG
TTCTAAGGGCGTCCCTGAGCCCCAAGGAGATCTTGCAACGCATACTGCTTCGTTCGCGAAACAAGGCTTTAATGTGAGCGAGATGATTGGTCTCGTGGCATGTGGACACACTCTAGGTGG
TGTCCACGAGCAAGATTTTTCTACAATTGTGCAGGGAGAGACGAATGCAGATAACAACACGAGTGGAATGCAACATTTCGACGACTCTTTTGACTCTTTCGACAACCACAT
ATGTGCGGC
TTCTCCTCTTCTGCATTCTGCCTATCCTAAAATATCCTGATATTCAATCATTTGTTGATAGCGCTGTACAATGGATGAACAGTAGTACTTCTACCAATACACTGGCGACTGGCTTCAATA
CCACGACAAACTCGGATGCGCGTATATTTGCTGCCGACGGCAATGCCACCATGCGCGACCTCGCTTCCAACAACCAAGTCTTTCAGGACCGATGCGCCTATCTTCTTTCACGGATGATCC
ATACCGTCCCAAAAGGCGTTCAATTGACAGATGTTATCACTCCCATTCCCGTCAAGCCCTGGCTTGCTCAATTGAGTATTGACAACAACGGAAAGCTGCAATTTGAAGGCTATATCAGG
G
GGTACGAGAAGCAATTTTGCCGTGATTGATGACTGACGGATTGTATTCTTAATCATAGATCTTCTCTACAAACAAGTCCCAGTCTCCCAGAGACTACGCCGTCAAAAGTGAGTTGTCTCA
CCGAGAGTAGGACTCGCTGGAGGCCTGAAATTTCACATGTAGCATGACCTGGACGGATCACAATGGTGCAGCCTGTGACGGCTGTAGTGCTACGGCAAGATTCCCTGGGCTCTTCAGCGG
CTCGTTCTGGGGCGCGGTCGCGTTGTTCCACTTCAACATTACCATCGATCCGAGCGTTGGATTCTCTGCATTCAGCGTAGAGTATACAAACACTCCCGGGGGACCTCTAACCAAAGCAGA
TAATGATGGAGCTGGTTTCCCTTTCGACGACGTTGCTGTGCTGCACAAGTCGGCCAGCTGCATTGCTAACGATGGTAGCGTCAAAGCTGTCGTTGCG
CGGTACATCTTGTTGCTTCCAAC
AACGTTGTAACTTTCAACTGATTTGTTGTCAAATACCTTGTTAGATCCGCAATGACCAGAAGATAATGTCGGCATATATCATCGCCACATCAGCCGTGAAGCAGGCCGGCTCTATCGCTC
GCAAGCTGTCCACGGCCTTCGTCAACGTGACCGAAAGCGGCCCCTCCCTGTCCAGCTTGTACACTTTATATTCCGCCGAGTTTAACGTTGGCTTAGTAGAAAACGCTTCATTTGATCTTG
TCGTCGAGACCGGAGGTAAAACTCACATCACTGACTTCGTTCGCCCAAATGGTTTCCAGAGTTGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACGGGGTGTAGCAAGCCTTGTCATCCCGCTATCTATTTCACTCCTTTCAGACGGATACCAAAGGCCAGATACTGTCTACGACGCTCTCGAGGATTTGTACACGGTGAACAGCGGA
CTGGGTTCCAGCAATTTCATTGCAGGGGTTTCACCATGCAGTTTCGCTCCGGCTAATACCAGGACTACTGGCAGGCAAGCTGCTGCTGAGTGGGTCCGCAC
TGCGTACCATGATATGGCT
ACGGCAGATGTGGAAGCTGGCACTGGTGGAATTGATGCCTCTATCACTTTTGAGACCGATCGCGCAGAAAATGTCGGTGATGCTTTCAACGCCAGCTTCAATTTCTTTGTCGGGTTCCAA
AACAAGCGTGTATCCA
TGTCTGACCTCATCGCACTCGGAACTGTTTATGCTGTCCGTGCATGCTCAGGGCCTTCCATATCTTACCGGGCCGGTCGTATCGATGCCACAGGGCCTGGTTCT
AAGGGCGTCCCTGAGCCCCAAGGAGATCTTGCAACGCATACTGCTTCGTTCGCGAAACAAGGCTTTAATGTGAGCGAGATGATTGGTCTCGTGGCATGTGGACACACTCTAGGTGGTGTC
CACGAGCAAGATTTTTCTACAATTGTGCAGGGAGAGACGAATGCAGATAACAACACGAGTGGAATGCAACATTTCGACGACTCTTTTGACTCTTTCGACAACCACAT
CGCTGTACAATGG
ATGAACAGTAGTACTTCTACCAATACACTGGCGACTGGCTTCAATACCACGACAAACTCGGATGCGCGTATATTTGCTGCCGACGGCAATGCCACCATGCGCGACCTCGCTTCCAACAAC
CAAGTCTTTCAGGACCGATGCGCCTATCTTCTTTCACGGATGATCCATACCGTCCCAAAAGGCGTTCAATTGACAGATGTTATCACTCCCATTCCCGTCAAGCCCTGGCTTGCTCAATTG
AGTATTGACAACAACGGAAAGCTGCAATTTGAAGGCTATATCAGG
ATCTTCTCTACAAACAAGTCCCAGTCTCCCAGAGACTACGCCGTCAACATGACCTGGACGGATCACAATGGTGCA
GCCTGTGACGGCTGTAGTGCTACGGCAAGATTCCCTGGGCTCTTCAGCGGCTCGTTCTGGGGCGCGGTCGCGTTGTTCCACTTCAACATTACCATCGATCCGAGCGTTGGATTCTCTGCA
TTCAGCGTAGAGTATACAAACACTCCCGGGGGACCTCTAACCAAAGCAGATAATGATGGAGCTGGTTTCCCTTTCGACGACGTTGCTGTGCTGCACAAGTCGGCCAGCTGCATTGCTAAC
GATGGTAGCGTCAAAGCTGTCGTTGCG
ATCCGCAATGACCAGAAGATAATGTCGGCATATATCATCGCCACATCAGCCGTGAAGCAGGCCGGCTCTATCGCTCGCAAGCTGTCCACGGCC
TTCGTCAACGTGACCGAAAGCGGCCCCTCCCTGTCCAGCTTGTACACTTTATATTCCGCCGAGTTTAACGTTGGCTTAGTAGAAAACGCTTCATTTGATCTTGTCGTCGAGACCGGAGGT
AAAACTCACATCACTGACTTCGTTCGCCCAAATGGTTTCCAGAGTTGCTAG

Retrieve as FASTA