Entry information : HanAPx-CcP04 (hpox8 / HanAPx-CcP04)
Entry ID 10574
Creation 2012-02-28 (Christophe Dunand)
Last sequence changes 2012-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-23 (Catherine Mathe (Scipio))
Peroxidase information: HanAPx-CcP04 (hpox8 / HanAPx-CcP04)
Name (synonym) HanAPx-CcP04 (hpox8 / HanAPx-CcP04)
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Bondarzewiaceae Heterobasidion
Organism Heterobasidion annosum (root rot fungus)    [TaxId: 13563 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HanAPx-CcP04
start..stop
S start..stop
ShirAPx-CcP 569 0 26..525 27..530
CgeoAPx-CcP02 484 6.08e-168 28..527 31..515
PmelaAPx-CcP02_FUNGUS 471 1.71e-162 11..498 21..505
BdotAPx-CcP04 464 7.47e-160 49..526 34..515
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10574' 'join(90135..90375,90450..90596,90652..90865,90919..90953,91008..91089,91140..91259,91323..91494,91573..91887,91940..92200)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 90135..90375 239 N° 2 90450..90596 145 N° 3 90652..90865 212 N° 4 90919..90953 33
N° 5 91008..91089 80 N° 6 91140..91259 118 N° 7 91323..91494 170 N° 8 91573..91887 313
N° 9 91940..92200 259  
join(90135..90375,90450..90596,90652..90865,90919..90953,91008..91089,91140..912 59,91323..91494,91573..91887,91940..92200)


exon

Literature and cross-references HanAPx-CcP04 (hpox8 / HanAPx-CcP04)
DNA ref. JGI genome:   scaffold_05 (90135..92200)
Protein sequence: HanAPx-CcP04 (hpox8 / HanAPx-CcP04)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   528 (505)
PWM (Da):   %s   55875.96 (53153.4)  
PI (pH):   %s   4.43 (4.35) Peptide Signal:   %s   cut: 24 range:24-528
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAHISPLFLLLLPQNLIFSSFAFAPNPILVSNELEHLLVDTGGANDGGFKRAITPCTNYVEGSQLLGRETAAQWIRVAFHDFVTADVGTGVGGLDASIGFETLRAENSGTAMNDSLTFF
APFVSAQVSMADMIALSVVMSVGGCGGPHIPLRGGRIDATQAGVFGVPEPETDLEQTLEEFSGAGFNQSDAIALTACGHTMGNVHHGGFPQVVPESAVTPNNTGGGVHFDVTPANFDIDV
VQEYLSGTGQRGGPLVTTDNVTVRSDLRLYTSDNNQTLQALSQSSNYFRKACAQLFSRMIDTVPKDVKLTTIIEPMVYKPVNVSLGLTSDSNSSLSIYLDTSSSSNDPAPTLFISYETRL
GSPASHRVIATYTPDVENNGTSIFGNTYYYRFTASIDSSAGISAYTVANTSFALRDTIFFLPDLSSAQDNGSDTWSVNITAAALTSSNPSNVRAVLFTPTGQLGTLAPRIVTQNVTLNEI
GSVGVYKIYSAVVVVETINIGGASVDIVGSFAGGREVIDEFKKLSLII*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCCCACATTTCCCCATTGTTTCTGTTGCTTTTACCGCAGAATCTCATATTTTCTTCCTTTGCCTTTGCACCGAATCCAATCCTAGTATCAAACGAGCTCGAACACCTCCTCGTC
GACACAGGCGGTGCCAATGACGGTGGTTTCAAGCGCGCAATCACACCATGCACGAACTACGTGGAAGGGAGTCAGCTTCTGGGACGGGAGACAGCGGCGCAATGGATTCGAGTGGCCTTT
C
TCGTACGTGTTTAGCTCTGAGTTTTGGTGCCAGGCAGAGCCAGTCGCTGACAGCTGTTCCACCTTAATGCATGCAGATGACTTTGTTACTGCAGACGTGGGTACTGGCGTGGGCGGTTT
GGACGCGTCGATTGGGTTCGAGACGCTTCGTGCCGAGAATAGTGGAACGGCTATGAACGACTCGCTCACATTCTTCGCGCCCTTCGTTAGCGCTCAGGTATCCA
CAGTAAGCGATGCTGT
TTCTACAGATGTTTGCAATGGATTTCTCAAGAACGTGTCAGTGGCGGATATGATAGCGTTGAGCGTAGTGATGTCGGTAGGCGGTTGTGGCGGCCCTCATATTCCTCTTCGCGGAGGGCG
TATCGACGCTACACAAGCCGGAGTGTTCGGTGTCCCAGAGCCAGAGACCGATCTTGAACAGACATTGGAGGAGTTTTCCGGCGCTGGTTTCAATCAATCTGATGCCATTGCTCTCACGGC
ATGTGGGCATACGAT
ATGTAAGTTGTATGCTGCTCCTTCACGCTTAACAAGCCAATGACGACGTTGGTAGGGGCAATGTGCACCACGGAGGATTTCCCCAAGTCGCGGTATGGCAGCCTA
TTGATCCATCACCATCCTCAAACTATGACACGTGCATGCAGTACCGGAGTCTGCTGTTACACCAAACAATACGGGTGGAGGCGTCCATTTTGATGTCACGCCAGCTAATTTCGACATAGA
CGT
GTGTGAGACCTCCATGTTATAAACTCGCCTAACTCGCACTAATCATTTTCAGTGTTCAAGAATATTTGTCAGGAACCGGTCAGCGGGGAGGGCCTCTCGTGACAACAGACAATGTCA
CTGTACGCTCTGACCTTCGCCTGTACACTTCCGACAATAACCAAACACTCCAAGC
GCGTATGTACTACTATGATGGGTCTGGTCCCAGTCAGCTTTGACTCACCTCTTGCACATCATCAG

ATTGTCGCAGTCCTCTAATTATTTCAGGAAAGCATGCGCACAGCTTTTTTCCCGCATGATTGACACCGTCCCCAAAGATGTGAAATTGACCACGATTATTGAGCCCATGGTCTATAAGCC
GGTGAACGTCAGTTTGGGACTCACTTCAGACTCGAACAGCTCTCTGTCTATT
TTGTTTTCTCTGGCGCCGTCAGAGTAAGTTTCGAGAATGCTATTCGGGTCTTTCTAGCTTTGCTCACG
CCGATCAACCAGTATCTGGATACCTCGTCATCATCAAATGATCCTGCTCCAACTCTTTTCATCTCGTACGAGACCAGACTTGGGTCACCTGCTTCTCATAGAGTGATTGCGACATATACC
CCGGACGTCGAGAACAATGGCACGAGTATATTCGGCAACACATACTATTATCGTTTCACCGCTTCAATCGATTCGTCTGCCGGGATCTCTGCATATACAGTAGCAAATACCAGTTTTGCC
TTGCGGGATACAATATTTTTCCTCCCAGACTTGAGTTCTGCACAAGACAACGGCAGTGACACGTGGAGTGTTAACATCACCGCAGCC
CCGTAAGTGCGCAATTTTCTTACAAAAGTTTCC
AATGCTAAACTATAACGCAAGGCCTTGACATCGTCCAACCCCTCTAATGTCCGCGCCGTGCTCTTCACTCCTACGGGGCAGCTTGGAACGCTTGCTCCGCGGATTGTAACGCAGAACGTC
ACTCTGAATGAAATCGGATCCGTCGGCGTATACAAAATCTACTCCGCAGTTGTTGTAGTCGAGACTATCAATATCGGAGGCGCCAGCGTCGACATCGTAGGTTCATTCGCAGGGGGTCGG
GAAGTCATAGATGAATTCAAGAAGCTCAGTTTAATCATATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCCCACATTTCCCCATTGTTTCTGTTGCTTTTACCGCAGAATCTCATATTTTCTTCCTTTGCCTTTGCACCGAATCCAATCCTAGTATCAAACGAGCTCGAACACCTCCTCGTC
GACACAGGCGGTGCCAATGACGGTGGTTTCAAGCGCGCAATCACACCATGCACGAACTACGTGGAAGGGAGTCAGCTTCTGGGACGGGAGACAGCGGCGCAATGGATTCGAGTGGCCTTT
C
ATGACTTTGTTACTGCAGACGTGGGTACTGGCGTGGGCGGTTTGGACGCGTCGATTGGGTTCGAGACGCTTCGTGCCGAGAATAGTGGAACGGCTATGAACGACTCGCTCACATTCTTC
GCGCCCTTCGTTAGCGCTCAGGTATCCA
TGGCGGATATGATAGCGTTGAGCGTAGTGATGTCGGTAGGCGGTTGTGGCGGCCCTCATATTCCTCTTCGCGGAGGGCGTATCGACGCTACA
CAAGCCGGAGTGTTCGGTGTCCCAGAGCCAGAGACCGATCTTGAACAGACATTGGAGGAGTTTTCCGGCGCTGGTTTCAATCAATCTGATGCCATTGCTCTCACGGCATGTGGGCATACG
AT
GGGCAATGTGCACCACGGAGGATTTCCCCAAGTCGTACCGGAGTCTGCTGTTACACCAAACAATACGGGTGGAGGCGTCCATTTTGATGTCACGCCAGCTAATTTCGACATAGACGTT
GTTCAAGAATATTTGTCAGGAACCGGTCAGCGGGGAGGGCCTCTCGTGACAACAGACAATGTCACTGTACGCTCTGACCTTCGCCTGTACACTTCCGACAATAACCAAACACTCCAAGC
A
TTGTCGCAGTCCTCTAATTATTTCAGGAAAGCATGCGCACAGCTTTTTTCCCGCATGATTGACACCGTCCCCAAAGATGTGAAATTGACCACGATTATTGAGCCCATGGTCTATAAGCCG
GTGAACGTCAGTTTGGGACTCACTTCAGACTCGAACAGCTCTCTGTCTATT
TATCTGGATACCTCGTCATCATCAAATGATCCTGCTCCAACTCTTTTCATCTCGTACGAGACCAGACTT
GGGTCACCTGCTTCTCATAGAGTGATTGCGACATATACCCCGGACGTCGAGAACAATGGCACGAGTATATTCGGCAACACATACTATTATCGTTTCACCGCTTCAATCGATTCGTCTGCC
GGGATCTCTGCATATACAGTAGCAAATACCAGTTTTGCCTTGCGGGATACAATATTTTTCCTCCCAGACTTGAGTTCTGCACAAGACAACGGCAGTGACACGTGGAGTGTTAACATCACC
GCAGCC
GCCTTGACATCGTCCAACCCCTCTAATGTCCGCGCCGTGCTCTTCACTCCTACGGGGCAGCTTGGAACGCTTGCTCCGCGGATTGTAACGCAGAACGTCACTCTGAATGAAATC
GGATCCGTCGGCGTATACAAAATCTACTCCGCAGTTGTTGTAGTCGAGACTATCAATATCGGAGGCGCCAGCGTCGACATCGTAGGTTCATTCGCAGGGGGTCGGGAAGTCATAGATGAA
TTCAAGAAGCTCAGTTTAATCATATAA

Retrieve as FASTA