Entry information : EcamRboh03 ( EcC012018.20)
Entry ID 10580
Creation 2012-02-28 (Qiang Li)
Last sequence changes 2016-04-07 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-04-07 (Achraf Jemmat)
Peroxidase information: EcamRboh03 ( EcC012018.20)
Name (synonym) EcamRboh03 ( EcC012018.20)
Class Respiratory burst oxidase homolog     [Orthogroup: Rboh002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamRboh03
start..stop
S start..stop
EglRboh03 1170 0 1..604 1..603
EglRboh03 215 2.39e-60 574..678 710..814
EguRboh03 1121 0 29..604 13..587
EguRboh03 217 4.73e-61 574..678 694..798
EgrRboh03 1117 0 28..604 12..587
EgrRboh03 215 2.01e-60 574..678 694..798
JregRboh08 820 0 17..628 6..618
JregRboh08 189 3.47e-51 538..678 665..803
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10580' 'join(1..294,405..568,670..718,800..913,992..1798,1925..2020,2123..2238,2330..2408,2755..2883,2979..3057,3211..3320)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..294 292 N° 2 405..568 162 N° 3 670..718 47 N° 4 800..913 112
N° 5 992..1798 805 N° 6 1925..2020 94 N° 7 2123..2238 114 N° 8 2330..2408 77
N° 9 2755..2883 127 N° 10 2979..3057 77 N° 11 3211..3320 108  
join(1..294,405..568,670..718,800..913,992..1798,1925..2020,2123..2238,2330..240 8,2755..2883,2979..3057,3211..3320)


exon

Literature and cross-references EcamRboh03 ( EcC012018.20)
Protein sequence: EcamRboh03 ( EcC012018.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   678 (300)
PWM (Da):   %s   77542.44 (31599.7) Transmb domain:   %s   i262-281o348-370i398-420o446-468i
PI (pH):   %s   10.12 (5.95) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSAVEASESSAPPHPNDIPLPSRRSSSTTRKRNVSYGGIPRMERTASSASRGLMSLRFLDRTITGKEADAWRSIEKRFHQHATNGQLSRDKFGVSIGGMGDSKEFAGELFDALSRRRKV
NAENGISIDQLRQFWEDMTTRELESRLQIFFDMCDKNGDGRLTEDEVKEVIVLSAASNRLSNLQQQAASHASLIMERLDPDHQGYIEMWQLKTLLREMVNPDQRSKLSVNSQNLTRTMLP
KGYRKPMSRLVHKNIERIYDNWRRIWVVGLWLVANMILFLWKFNKTRHSPAFNITGYCLCYAKGSAETLNLNMALVLLPVCRRTLTKLRSSFLGTFIPFDDNINFHKIIALAIAIGSVVH
TAMHFMCNFPRITSCPKSQFMQVFGPSFHNRQPHYIDLVNNLSSTTGVLMFMMMAFSFTLATHWFRKNIVKLPWGLHHLAGFNAFWYAHHLLAVAYVFFILHGYFLVISRPWYTKTAWMY
VMVPILLYTSERAFTSASELQHRVDIAKAIVYSGNVLALYMSKPPGFNYNSGMYLFVKCPDISKFEWHPFSITSAPGDAFLSVHMRALGDWTxNVIEMHNYLTSLYEEGDARSALIAMVQ
KLQHAKNGVDIFSESRIKTHFARPNWRKVFSEIAMRHKSSRIGVFYCGSSVLTKTLRKLCQELSLESSTRFQFHKENF

Retrieve as FASTA  
Remarks Partial sequence from genomic (part of the sequence is missing due to NNNNNN in DNA). Incorrect prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACAGTGCGGTGGAAGCCAGTGAGAGCTCCGCCCCGCCGCATCCTAATGACATACCATTGCCATCGAGGCGGAGCTCAAGCACGACGCGGAAGAGGAATGTATCGTACGGCGGCATC
CCTAGGATGGAAAGAACGGCATCCAGTGCCTCTCGAGGCCTCATGAGCTTGAGGTTTCTGGATAGGACAATTACCGGGAAGGAAGCAGATGCCTGGAGATCAATCGAGAAGCGTTTCCAT
CAACACGCGACGAACGGCCAACTCTCGAGAGACAAATTTGGAGTCAGCATTGGT
GTTGATCCTTAGAAAGTCTTGCTGCTATCTGAATCATGATTTTCCAAATAATAATAATAATACTAA
TTGCACAATTTGATTGAGAAGTGACATTGTTTTAATCTGCGTGGAAGGAATGGGAGATTCCAAGGAATTTGCAGGAGAGTTATTCGACGCCTTATCAAGACGGAGGAAAGTGAATGCCGA
GAATGGAATATCAATAGACCAATTGAGACAATTTTGGGAAGACATGACGACTCGAGAACTCGAATCCCGGCTGCAGATATTCTTTGATAT
ATGTAAAGCAACTCTCGTCCATCTCCTATT
ATCGTTCGCAACCTAAAGCGTACATTGCGTTGCTGGTATTCCATGTGATGAAGTTTTGCGACGAATGCTGCAGGTGTGACAAGAATGGTGATGGGAGGCTAACTGAGGATGAGGTAAAAG
AG
AGGTGAGGCAAAAGGAGACTTACTAATCACTCGTTTAGCGTGTCCTTTGGGCTCTTTTATGATGGACTGGAAATTTTTCAAAGGTGATAGTGTTGAGCGCCGCCTCGAATAGGCTGTC
GAATCTCCAGCAGCAAGCGGCATCTCACGCATCTTTGATCATGGAAAGACTTGATCCCGACCATCAAGGGTACATCGAG
AGGTACCAAGTCAGATAGTCCATCATGTCCTGTTCGAGTTC
GTGTTCCTCCCATGTTGTTCATCGCTTCTTTGTTTTCAGATGTGGCAATTAAAGACTCTACTGAGAGAAATGGTGAACCCTGATCAAAGGAGCAAGTTGTCAGTGAATTCTCAAAACCTG
ACCAGAACCATGCTTCCCAAAGGATACAGAAAACCAATGAGTCGGCTCGTGCACAAGAACATCGAAAGGATCTATGACAATTGGAGGCGAATATGGGTCGTCGGGCTGTGGCTGGTCGCA
AACATGATCCTCTTCCTTTGGAAGTTTAACAAAACGAGGCACAGCCCCGCCTTTAACATCACGGGCTATTGTCTTTGCTACGCCAAGGGCTCTGCCGAGACACTCAATCTCAACATGGCT
CTCGTCCTCCTCCCCGTATGCAGAAGAACTCTCACGAAGCTACGGTCGTCCTTCCTTGGTACCTTCATACCATTCGACGACAACATAAACTTCCACAAGATAATCGCGCTGGCCATAGCT
ATAGGATCTGTCGTTCACACTGCAATGCATTTTATGTGCAACTTCCCCAGGATAACTTCATGCCCAAAATCACAATTCATGCAAGTGTTTGGCCCGAGCTTCCATAATAGGCAACCTCAT
TACATCGACTTGGTCAATAACTTGTCCAGCACCACCGGGGTTCTCATGTTCATGATGATGGCCTTCTCTTTCACACTGGCGACTCATTGGTTCAGGAAAAACATCGTCAAGCTACCGTGG
GGGCTCCATCATTTAGCAGGATTTAATGCCTTCTGGTACGCACATCATTTGCTAGCCGTTGCCTATGTCTTCTTCATACTTCACGGCTACTTCCTCGTGATCAGTCGACCTTGGTACACG
AAAACG
CGGTAAGTACACAATGGTCTAATTCCTTATTCTGTTCACCATTAATTCATAAGGCCTGAATTCTCCGGTAGTACCATCATTCCTCTGAAAACACGGCAAGAATCATTATACGGT
TGGACTTTATGCAGGCATGGATGTATGTGATGGTCCCAATCCTACTCTACACAAGCGAGAGAGCATTCACATCTGCTTCTGAACTCCAACATCGAGTTGATATCGCTAAGAGGTATCACT
CACTTTACCGAACTGCCGTGTTCCACATTCCTTTTTGGTTTACACGAATCTTAGTGCTACGATAAATTCATGCTCGGCTCAAAAAACTTTTCAGGCCATTGTTTATTCTGGAAACGTCCT
TGCATTGTACATGAGCAAGCCTCCAGGTTTCAACTACAACAGCGGAATGTACCTTTTCGTCAAATGCCCTGATATATCAAAGTTCGAATG
TGGTGTATAGAACATAATCGCTGAAACCTA
TTTACTCGTCATACCCCTATGGCTTTTATTGCTGAAACTCATCGGTGTTTTTGCTCGGGACAGGCATCCTTTCTCCATTACTTCCGCACCGGGAGATGCCTTCTTGAGTGTTCACATGCG
AGCCTTGGGCGATTGGACNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGAATCCTCCAATTAATTATAGTTTTTCAACTAAAATGTCGCTTTGGGTACTGGTG
ATTGTTGTAGAATGTAATAGAGATGCACAACTACCTGACCTCTCTATATGAGGAAGGAGATGCAAGATCAGCACTCATTGCCATGGTCCAAAAGTTGCAGCATGCGAAGAATGGCGTCGA
CATCTTCTCGGAAAGTCGG
GGGTAACTCTTGATCAGTCACCCAAAAGAAAAACAAAGAAACATTCACAGCACAATGCACCTATTTAGGCTGTCCTTTAACGTTGCTTGTTCGACAGATAA
AAACTCACTTTGCGAGGCCTAATTGGAGAAAGGTGTTCTCTGAAATTGCAATGCGGCACAAGTCGTCTCGTATAG
AGGTATGACATCACATCCGATGAACGTGTCAACATAATGGCACTT
GATTTGGTTGTTCTAGCCAGTTTGGAACATGAACCTGTGATTTTCTAACTGTTGGAACTTGAACATTCTACCAATTCGGGTCTGATATGTCGGTAATAATTTTCCTGCAGGTGTTTTCTA
TTGTGGGAGTTCGGTGCTCACCAAAACACTGAGGAAGCTATGTCAAGAACTCAGCCTAGAGTCGTCAACTCGCTTCCAATTCCACAAGGAAAACTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACAGTGCGGTGGAAGCCAGTGAGAGCTCCGCCCCGCCGCATCCTAATGACATACCATTGCCATCGAGGCGGAGCTCAAGCACGACGCGGAAGAGGAATGTATCGTACGGCGGCATC
CCTAGGATGGAAAGAACGGCATCCAGTGCCTCTCGAGGCCTCATGAGCTTGAGGTTTCTGGATAGGACAATTACCGGGAAGGAAGCAGATGCCTGGAGATCAATCGAGAAGCGTTTCCAT
CAACACGCGACGAACGGCCAACTCTCGAGAGACAAATTTGGAGTCAGCATTGGT
GGAATGGGAGATTCCAAGGAATTTGCAGGAGAGTTATTCGACGCCTTATCAAGACGGAGGAAAGTG
AATGCCGAGAATGGAATATCAATAGACCAATTGAGACAATTTTGGGAAGACATGACGACTCGAGAACTCGAATCCCGGCTGCAGATATTCTTTGATAT
GTGTGACAAGAATGGTGATGGG
AGGCTAACTGAGGATGAGGTAAAAGAG
GTGATAGTGTTGAGCGCCGCCTCGAATAGGCTGTCGAATCTCCAGCAGCAAGCGGCATCTCACGCATCTTTGATCATGGAAAGACTTGATCCC
GACCATCAAGGGTACATCGAG
ATGTGGCAATTAAAGACTCTACTGAGAGAAATGGTGAACCCTGATCAAAGGAGCAAGTTGTCAGTGAATTCTCAAAACCTGACCAGAACCATGCTTCCC
AAAGGATACAGAAAACCAATGAGTCGGCTCGTGCACAAGAACATCGAAAGGATCTATGACAATTGGAGGCGAATATGGGTCGTCGGGCTGTGGCTGGTCGCAAACATGATCCTCTTCCTT
TGGAAGTTTAACAAAACGAGGCACAGCCCCGCCTTTAACATCACGGGCTATTGTCTTTGCTACGCCAAGGGCTCTGCCGAGACACTCAATCTCAACATGGCTCTCGTCCTCCTCCCCGTA
TGCAGAAGAACTCTCACGAAGCTACGGTCGTCCTTCCTTGGTACCTTCATACCATTCGACGACAACATAAACTTCCACAAGATAATCGCGCTGGCCATAGCTATAGGATCTGTCGTTCAC
ACTGCAATGCATTTTATGTGCAACTTCCCCAGGATAACTTCATGCCCAAAATCACAATTCATGCAAGTGTTTGGCCCGAGCTTCCATAATAGGCAACCTCATTACATCGACTTGGTCAAT
AACTTGTCCAGCACCACCGGGGTTCTCATGTTCATGATGATGGCCTTCTCTTTCACACTGGCGACTCATTGGTTCAGGAAAAACATCGTCAAGCTACCGTGGGGGCTCCATCATTTAGCA
GGATTTAATGCCTTCTGGTACGCACATCATTTGCTAGCCGTTGCCTATGTCTTCTTCATACTTCACGGCTACTTCCTCGTGATCAGTCGACCTTGGTACACGAAAACG
GCATGGATGTAT
GTGATGGTCCCAATCCTACTCTACACAAGCGAGAGAGCATTCACATCTGCTTCTGAACTCCAACATCGAGTTGATATCGCTAAG
GCCATTGTTTATTCTGGAAACGTCCTTGCATTGTAC
ATGAGCAAGCCTCCAGGTTTCAACTACAACAGCGGAATGTACCTTTTCGTCAAATGCCCTGATATATCAAAGTTCGAATG
GCATCCTTTCTCCATTACTTCCGCACCGGGAGATGCCTTC
TTGAGTGTTCACATGCGAGCCTTGGGCGATTGGACNNNN
AATGTAATAGAGATGCACAACTACCTGACCTCTCTATATGAGGAAGGAGATGCAAGATCAGCACTCATTGCCATGGTCCAA
AAGTTGCAGCATGCGAAGAATGGCGTCGACATCTTCTCGGAAAGTCGG
ATAAAAACTCACTTTGCGAGGCCTAATTGGAGAAAGGTGTTCTCTGAAATTGCAATGCGGCACAAGTCGTCT
CGTATAG
GTGTTTTCTATTGTGGGAGTTCGGTGCTCACCAAAACACTGAGGAAGCTATGTCAAGAACTCAGCCTAGAGTCGTCAACTCGCTTCCAATTCCACAAGGAAAACTTTTAG

Retrieve as FASTA