1. Browse the Database
  2. View Redoxidase
Entry information : EcamGPx08 ( EcC014473.60)
Entry ID 10585
Creation 2012-02-28 (Qiang Li)
Last sequence changes 2016-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Mbadinga
Last annotation changes 2016-02-29 (Mbadinga)
Peroxidase information: EcamGPx08 ( EcC014473.60)
Name (synonym) EcamGPx08 ( EcC014473.60)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamGPx08
start..stop		 S start..stop
EglGPx08 347 1.01e-124 1..169 1..170
EgrGPx08 346 1.86e-124 1..170 1..171
EguGPx08 329 6.47e-118 1..169 1..170
EguGPx09 263 8.12e-92 1..169 1..170
Gene structure Fichier Exons►


exon

Literature and cross-references EcamGPx08 ( EcC014473.60)
Protein sequence: EcamGPx08 ( EcC014473.60)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   19155.81  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAQSADEKSLHQFVVKDSKGNEVNLSAYEGKVLLVVNVASKGFTEQNYSQLAELHNRYKDKGFEILAFPCNQFLRQEPDTSQEVEDFACNRYKVEFPIFQKVCVNGQETAPLYKYLKA
RKTGFLGSRIKWNFTKFLVDKEGRVISRYGTITPPLAIEEDIQKALGMA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from Kazusa.
DNA ►
Send to BLAST
CDS►
Send to BLAST