Entry information : CtheGPx01
Entry ID 10586
Creation 2012-02-29 (Christophe Dunand)
Last sequence changes 2012-02-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-02-29 (Christophe Dunand)
Peroxidase information: CtheGPx01
Name CtheGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium thermophilum    [TaxId: 209285 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CtheGPx01
start..stop
S start..stop
TterGPx01 280 2.8e-96 77..254 52..232
CgraGPx01 266 1.12e-90 87..253 69..234
StheGPx01 266 1.57e-90 17..254 9..237
ChigGPx01 265 7.9e-90 87..254 73..239
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '10586' 'join(1..301,365..828)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..301 299 N° 2 365..828 462  
join(1..301,365..828)


exon

Literature and cross-references CtheGPx01
DNA ref. GenBank:   ADUW01000022.1 (1015401..1016231)
Protein sequence: CtheGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   254 (155)
PWM (Da):   %s   28576.02 (16611.0)  
PI (pH):   %s   10.06 (4.13) Peptide Signal:   %s   cut: 29 range:29-183
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLCCHSLKEAGLRVLITRPFIVLLKPFIATSSATISSPNGSISS
AITHKRLLKRKAHLTCVFKLDKSQGFSVAQSRLQPSVFQRPLTTMSSFYDFKPLD
KTGKEVDLSKYKGKFVLVVNTASKCGFTPQYAGLEKLYKSIREKHGDKFEILGFPCNQFGWQEPGTNDEIQQFCQLNYGVTFPIMAKIDVNGPNAIPLYQWLKSQKPRFGGYVERVLWNF
EKFLIGKDGSVKGRWLSATKPESLEQTILEELEK

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCTGTTGCCACAGCTTGAAGGAAGCAGGCCTTCGCGTCTTGATTACTCGCCCCTTCATTGTACTATTGAAGCCATTTATTGCAACAAGTTCTGCTACTATCTCTTCTCCCAAC
GGTTCCATATCATCAGCAATAACACATAAGCGACTCCTCAAACGAAAGGCGCATCTGACCTGTGTCTTCAAACTCGACAAGTCTCAGGGATTTTCTGTTGCTCAATCTAGACTGCAGCCA
TCGGTGTTTCAAAGACCGCTCACAACCATGTCTTCTTTCTACGATTTCAAGCCTCTCGACA
CAGTGAGTGAAGCCAAGTTCCACATCTTGTCTTCAATATCACAAAGCTCACGTTACATG
TCTCAGAGACTGGCAAGGAAGTGGATTTGTCCAAATATAAGGGCAAGTTTGTCCTGGTTGTCAACACAGCTTCCAAGTGCGGATTCACCCCTCAGTATGCCGGCCTTGAGAAGCTGTACA
AGTCGATCCGTGAGAAGCACGGTGACAAGTTCGAAATCCTAGGCTTCCCTTGTAACCAGTTCGGCTGGCAGGAGCCCGGTACCAACGACGAAATCCAGCAATTTTGCCAGCTCAACTATG
GAGTCACCTTCCCCATCATGGCCAAGATCGATGTCAATGGCCCCAATGCCATCCCTCTTTATCAGTGGTTGAAGTCTCAAAAGCCCCGTTTTGGAGGCTATGTCGAGCGTGTCCTCTGGA
ACTTTGAGAAGTTTTTGATCGGGAAGGATGGCAGTGTCAAGGGGCGATGGCTGTCCGCTACCAAGCCAGAGTCGCTGGAGCAGACTATTCTGGAGGAGCTGGAAAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCTGTTGCCACAGCTTGAAGGAAGCAGGCCTTCGCGTCTTGATTACTCGCCCCTTCATTGTACTATTGAAGCCATTTATTGCAACAAGTTCTGCTACTATCTCTTCTCCCAAC
GGTTCCATATCATCAGCAATAACACATAAGCGACTCCTCAAACGAAAGGCGCATCTGACCTGTGTCTTCAAACTCGACAAGTCTCAGGGATTTTCTGTTGCTCAATCTAGACTGCAGCCA
TCGGTGTTTCAAAGACCGCTCACAACCATGTCTTCTTTCTACGATTTCAAGCCTCTCGACA
AGACTGGCAAGGAAGTGGATTTGTCCAAATATAAGGGCAAGTTTGTCCTGGTTGTCAAC
ACAGCTTCCAAGTGCGGATTCACCCCTCAGTATGCCGGCCTTGAGAAGCTGTACAAGTCGATCCGTGAGAAGCACGGTGACAAGTTCGAAATCCTAGGCTTCCCTTGTAACCAGTTCGGC
TGGCAGGAGCCCGGTACCAACGACGAAATCCAGCAATTTTGCCAGCTCAACTATGGAGTCACCTTCCCCATCATGGCCAAGATCGATGTCAATGGCCCCAATGCCATCCCTCTTTATCAG
TGGTTGAAGTCTCAAAAGCCCCGTTTTGGAGGCTATGTCGAGCGTGTCCTCTGGAACTTTGAGAAGTTTTTGATCGGGAAGGATGGCAGTGTCAAGGGGCGATGGCTGTCCGCTACCAAG
CCAGAGTCGCTGGAGCAGACTATTCTGGAGGAGCTGGAAAAATGA

Retrieve as FASTA